Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.47
PubTator Score 3.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 2.5e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Ornithine translocase deficiency 7 7.098 3.5
Urea cycle disorder 7 3.652 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 2.5e-04

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (6)

AA Sequence

MKSGPGIQAAIDLTAGAAGGTACVLTGQPFDTIKVKMQTFPDLYKGLTDCFLKTYAQVGLRGFYKGTGPA      1 - 70
LMAYVAENSVLFMCYGFCQQFVRKVAGMDKQAKLSDLQTAAAGSFASAFAALALCPTELVKCRLQTMYEM     71 - 140
EMSGKIAKSHNTIWSVVKGILKKDGPLGFYHGLSSTLLQEVPGYFFFFGGYELSRSFFASGRSKDELGPV    141 - 210
HLMLSGGVAGICLWLVVFPVDCIKSRIQVLSMYGKQAGFIGTLLSVVRNEGIVALYSGLKATMIRAIPAN    211 - 280
GALFVAYEYSRKMMMKQLEAY                                                     281 - 301
//

Text Mined References (13)

PMID Year Title