Property Summary

NCBI Gene PubMed Count 21
Grant Count 2
Funding $18,500
PubMed Score 26.74
PubTator Score 20.74

Knowledge Summary

Patent (3,242)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Breast cancer 3,094

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer -2.500 0.000

Synonym

Accession Q9BXC0 B2R9X4 Q3Y5J3 Q4VBN1 Q6NXU5
Symbols HCA1
GPR81
LACR1
FKSG80
GPR104
TAGPCR
TA-GPCR

Gene

PANTHER Protein Class (2)

 Grant Application (2)

  TechDev Info (1)

Gene RIF (10)

PMID Text
26208712 HCAR1 and monocarboxylate transporters activity is required for the L- and D-lactate-mediated enhancement of DNA repair and of HeLa cell survival.
25839160 HCA1/3 are necessary for breast cancer cells to balance lipid/fatty acid metabolism.
24928781 Data support that GPR81 is important for cancer cell regulation of lactate transport mechanisms.
24657625 Lactate negatively regulates TLR induction of the NLRP3 inflammasome and production of IL1beta, via ARRB2 and GPR81 in liver and pancreatic injury.
24486398 Description of a GPR81 selective agonist with in vivo efficacy, inhibiting lipolysis without flushing.
21862690 demonstrated that the C165-E166-S167-F168 motif at the second extracellular loop is critical for GPR81 function, and the conserved six Cys residues at the extracellular regions are necessary for GPR81 function
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19633298 Data show that the coordinated PPARgamma-mediated regulation of the GPR81, GPR109A and GPR109B presents a novel mechanism by which TZDs may reduce circulating free fatty acid levels and perhaps ameliorate insulin resistance in obese patients.
18952058 GPR81 with relatively restricted expression in the adipose tissues functions as a receptor for lactate and can mediate an anti-lipolytic effect of lactate.

AA Sequence

MYNGSCCRIEGDTISQVMPPLLIVAFVLGALGNGVALCGFCFHMKTWKPSTVYLFNLAVADFLLMICLPF      1 - 70
RTDYYLRRRHWAFGDIPCRVGLFTLAMNRAGSIVFLTVVAADRYFKVVHPHHAVNTISTRVAAGIVCTLW     71 - 140
ALVILGTVYLLLENHLCVQETAVSCESFIMESANGWHDIMFQLEFFMPLGIILFCSFKIVWSLRRRQQLA    141 - 210
RQARMKKATRFIMVVAIVFITCYLPSVSARLYFLWTVPSSACDPSVHGALHITLSFTYMNSMLDPLVYYF    211 - 280
SSPSFPKFYNKLKICSLKPKQPGHSKTQRPEEMPISNLGRRSCISVANSFQSQSDGQWDPHIVEWH        281 - 346
//

Text Mined References (22)

PMID Year Title
26208712 2015 L- and D-lactate enhance DNA repair and modulate the resistance of cervical carcinoma cells to anticancer drugs via histone deacetylase inhibition and hydroxycarboxylic acid receptor 1 activation.
25839160 2015 Hydroxycarboxylic acid receptors are essential for breast cancer cells to control their lipid/fatty acid metabolism.
24928781 2014 Cell surface lactate receptor GPR81 is crucial for cancer cell survival.
24657625 2014 Lactate reduces liver and pancreatic injury in Toll-like receptor- and inflammasome-mediated inflammation via GPR81-mediated suppression of innate immunity.
24486398 2014 Identification of a novel GPR81-selective agonist that suppresses lipolysis in mice without cutaneous flushing.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21907911 2011 Biological and pharmacological roles of HCA receptors.
21862690 2011 Study of GPR81, the lactate receptor, from distant species identifies residues and motifs critical for GPR81 functions.
21454438 2011 International Union of Basic and Clinical Pharmacology. LXXXII: Nomenclature and Classification of Hydroxy-carboxylic Acid Receptors (GPR81, GPR109A, and GPR109B).
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...