Property Summary

NCBI Gene PubMed Count 48
Grant Count 47
R01 Count 24
Funding $10,849,494.08
PubMed Score 138.39
PubTator Score 87.41

Knowledge Summary

Patent (7,439)

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -3.351 0.000
colon cancer -2.700 0.000
ulcerative colitis -4.400 0.000
group 3 medulloblastoma -1.200 0.008
Endometriosis -3.186 0.048
Pick disease -1.400 0.001
progressive supranuclear palsy -1.300 0.028
ovarian cancer 1.300 0.000
head and neck cancer 1.300 0.007
psoriasis 1.200 0.000

Gene RIF (42)

PMID Text
26563869 Data show that resistant cells express lower amounts of the transient receptor potential cation channel subfamily M TRPM6 and 7, both involved in magnesium transport.
26179995 The Different Roles of The Channel-Kinases TRPM6 and TRPM7
26058915 we showed that two serum magnesium associated loci, MUC1 and TRPM6, had significant effect modification with progestin use and insulin levels, respectively, in European Americans.
25796343 TRPM6 mRNA and protein levels in atrial fibrillation group were elevated markedly in comparison with sinus rhythm group.
25277194 N-Myc can promote neuroblastoma cell proliferation through up-regulation of the channel kinases TRPM6 and TRPM7
24906182 Knowledge of TRPM6 functioning is of vital importance to decipher its role in Mg handling and will, in particular, provide a molecular basis for achieving a better understanding of Mg mal(re)absorption and hence systemic Mg balance.
24858416 Data indicate heteromer formation between channel kinases TRPM6 and TRPM7 influences the biological activity of the ion channels.
24650431 TRPM6 kinase activity is linked to channel activity through a kinase-independent mechanism involving the dimerization motif binding to a pocket within the kinase domain.
24385424 TRPM6 modulates the functionality of TRPM7, and the TRPM6 kinase plays a critical role in tuning the phenotype of the TRPM7.M6 channel complex.
23942199 We conclude that the new TRPM6 missense mutations lead to dysregulated intestinal/renal Mg(2+) (re)absorption as a consequence of loss of TRPM6 channel function.
More...

AA Sequence

MKEQPVLERLQSQKSWIKGVFDKRECSTIIPSSKNPHRCTPVCQVCQNLIRCYCGRLIGDHAGIDYSWTI      1 - 70
SAAKGKESEQWSVEKHTTKSPTDTFGTINFQDGEHTHHAKYIRTSYDTKLDHLLHLMLKEWKMELPKLVI     71 - 140
SVHGGIQNFTMPSKFKEIFSQGLVKAAETTGAWIITEGINTGVSKHVGDALKSHSSHSLRKIWTVGIPPW    141 - 210
GVIENQRDLIGKDVVCLYQTLDNPLSKLTTLNSMHSHFILSDDGTVGKYGNEMKLRRNLEKYLSLQKIHC    211 - 280
RSRQGVPVVGLVVEGGPNVILSVWETVKDKDPVVVCEGTGRAADLLAFTHKHLADEGMLRPQVKEEIICM    281 - 350
IQNTFNFSLKQSKHLFQILMECMVHRDCITIFDADSEEQQDLDLAILTALLKGTNLSASEQLNLAMAWDR    351 - 420
VDIAKKHILIYEQHWKPDALEQAMSDALVMDRVDFVKLLIEYGVNLHRFLTIPRLEELYNTKQGPTNTLL    421 - 490
HHLVQDVKQHTLLSGYRITLIDIGLVVEYLIGRAYRSNYTRKHFRALYNNLYRKYKHQRHSSGNRNESAE    491 - 560
STLHSQFIRTAQPYKFKEKSIVLHKSRKKSKEQNVSDDPESTGFLYPYNDLLVWAVLMKRQKMAMFFWQH    561 - 630
GEEATVKAVIACILYRAMAHEAKESHMVDDASEELKNYSKQFGQLALDLLEKAFKQNERMAMTLLTYELR    631 - 700
NWSNSTCLKLAVSGGLRPFVSHTCTQMLLTDMWMGRLKMRKNSWLKIIISIILPPTILTLEFKSKAEMSH    701 - 770
VPQSQDFQFMWYYSDQNASSSKESASVKEYDLERGHDEKLDENQHFGLESGHQHLPWTRKVYEFYSAPIV    771 - 840
KFWFYTMAYLAFLMLFTYTVLVEMQPQPSVQEWLVSIYIFTNAIEVVREICISEPGKFTQKVKVWISEYW    841 - 910
NLTETVAIGLFSAGFVLRWGDPPFHTAGRLIYCIDIIFWFSRLLDFFAVNQHAGPYVTMIAKMTANMFYI    911 - 980
VIIMAIVLLSFGVARKAILSPKEPPSWSLARDIVFEPYWMIYGEVYAGEIDVCSSQPSCPPGSFLTPFLQ    981 - 1050
AVYLFVQYIIMVNLLIAFFNNVYLDMESISNNLWKYNRYRYIMTYHEKPWLPPPLILLSHVGLLLRRLCC   1051 - 1120
HRAPHDQEEGDVGLKLYLSKEDLKKLHDFEEQCVEKYFHEKMEDVNCSCEERIRVTSERVTEMYFQLKEM   1121 - 1190
NEKVSFIKDSLLSLDSQVGHLQDLSALTVDTLKVLSAVDTLQEDEALLAKRKHSTCKKLPHSWSNVICAE   1191 - 1260
VLGSMEIAGEKKYQYYSMPSSLLRSLAGGRHPPRVQRGALLEITNSKREATNVRNDQERQETQSSIVVSG   1261 - 1330
VSPNRQAHSKYGQFLLVPSNLKRVPFSAETVLPLSRPSVPDVLATEQDIQTEVLVHLTGQTPVVSDWASV   1331 - 1400
DEPKEKHEPIAHLLDGQDKAEQVLPTLSCTPEPMTMSSPLSQAKIMQTGGGYVNWAFSEGDETGVFSIKK   1401 - 1470
KWQTCLPSTCDSDSSRSEQHQKQAQDSSLSDNSTRSAQSSECSEVGPWLQPNTSFWINPLRRYRPFARSH   1471 - 1540
SFRFHKEEKLMKICKIKNLSGSSEIGQGAWVKAKMLTKDRRLSKKKKNTQGLQVPIITVNACSQSDQLNP   1541 - 1610
EPGENSISEEEYSKNWFTVSKFSHTGVEPYIHQKMKTKEIGQCAIQISDYLKQSQEDLSKNSLWNSRSTN   1611 - 1680
LNRNSLLKSSIGVDKISASLKSPQEPHHHYSAIERNNLMRLSQTIPFTPVQLFAGEEITVYRLEESSPLN   1681 - 1750
LDKSMSSWSQRGRAAMIQVLSREEMDGGLRKAMRVVSTWSEDDILKPGQVFIVKSFLPEVVRTWHKIFQE   1751 - 1820
STVLHLCLREIQQQRAAQKLIYTFNQVKPQTIPYTPRFLEVFLIYCHSANQWLTIEKYMTGEFRKYNNNN   1821 - 1890
GDEITPTNTLEELMLAFSHWTYEYTRGELLVLDLQGVGENLTDPSVIKPEVKQSRGMVFGPANLGEDAIR   1891 - 1960
NFIAKHHCNSCCRKLKLPDLKRNDYSPERINSTFGLEIKIESAEEPPARETGRNSPEDDMQL           1961 - 2022
//

Text Mined References (49)

PMID Year Title
26563869 2015 Magnesium homeostasis in colon carcinoma LoVo cells sensitive or resistant to doxorubicin.
26179995 2015 The Different Roles of The Channel-Kinases TRPM6 and TRPM7.
26058915 2015 Genetic loci for serum magnesium among African-Americans and gene-environment interaction at MUC1 and TRPM6 in European-Americans: the Atherosclerosis Risk in Communities (ARIC) study.
25796343 2015 Increased TRPM6 expression in atrial fibrillation patients contribute to atrial fibrosis.
25277194 2014 N-Myc-induced up-regulation of TRPM6/TRPM7 channels promotes neuroblastoma cell proliferation.
24906182 2014 Mg2+ homeostasis: the balancing act of TRPM6.
24858416 2014 TRPM6 kinase activity regulates TRPM7 trafficking and inhibits cellular growth under hypomagnesic conditions.
24650431 2014 Kinase and channel activity of TRPM6 are co-ordinated by a dimerization motif and pocket interaction.
24385424 2014 The TRPM6 kinase domain determines the Mg·ATP sensitivity of TRPM7/M6 heteromeric ion channels.
23942199 2014 New TRPM6 missense mutations linked to hypomagnesemia with secondary hypocalcemia.
More...