Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.57
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 4.6e-06
primary pancreatic ductal adenocarcinoma 1109 5.9e-05
pancreatic cancer 2398 8.5e-04
Breast cancer 3578 2.4e-02
Disease Target Count Z-score Confidence
Candidiasis 55 3.888 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer 3.100 2.4e-02
ovarian cancer -1.800 4.6e-06
pancreatic cancer 1.400 8.5e-04
primary pancreatic ductal adenocarcinoma 1.949 5.9e-05

AA Sequence

MVLGGCPVSYLLLCGQAALLLGNLLLLHCVSRSHSQNATAEPELTSAGAAQPEGPGGAASWEYGDPHSPV      1 - 70
ILCSYLPDEFIECEDPVDHVGNATASQELGYGCLKFGGQAYSDVEHTSVQCHALDGIECASPRTFLRENK     71 - 140
PCIKYTGHYFITTLLYSFFLGCFGVDRFCLGHTGTAVGKLLTLGGLGIWWFVDLILLITGGLMPSDGSNW    141 - 210
CTVY                                                                      211 - 214
//

Text Mined References (7)

PMID Year Title