Property Summary

NCBI Gene PubMed Count 6
PubMed Score 8.05
PubTator Score 6.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
gastric cancer 1.100 0.006
hepatocellular carcinoma 1.900 0.000
pancreatic cancer 1.600 0.002
osteosarcoma -2.279 0.000
glioblastoma 1.500 0.001
cystic fibrosis 2.556 0.000
non-small cell lung cancer -1.177 0.000
intraductal papillary-mucinous adenoma (... 1.600 0.003
intraductal papillary-mucinous neoplasm ... 1.500 0.016
active Crohn's disease 2.802 0.002
active ulcerative colitis 3.716 0.005
breast carcinoma -1.200 0.000
fibroadenoma -1.100 0.017
pediatric high grade glioma 1.400 0.000
pilocytic astrocytoma 1.700 0.000
pancreatic carcinoma 1.600 0.002
psoriasis 1.900 0.000
subependymal giant cell astrocytoma 3.337 0.006
lung adenocarcinoma -1.200 0.000
lung carcinoma -2.000 0.000
Breast cancer -1.400 0.000
invasive ductal carcinoma -1.400 0.010
ovarian cancer -1.300 0.000
pituitary cancer -1.500 0.000

Gene RIF (4)

PMID Text
20025480 The increased expression of CARD6 in esophageal squamous cell carcinoma,gastric and colorectal adenocarcinoma suggested that neoexpression of CARD6 might be related to activation of NF-kappaB pathway.
16582588 review of the regulation of interactions of CARD6 with RICK and microtubules [review]
16418290 CARD6 is a regulator of NF-kappaB activation that modulates the functions of RICK protein
12775719 identification as a modulator of NF-kappa B activation by Nod1- and Cardiak-mediated pathways

AA Sequence

MATESTPSEIIERERKKLLEILQHDPDSILDTLTSRRLISEEEYETLENVTDLLKKSRKLLILVQKKGEA      1 - 70
TCQHFLKCLFSTFPQSAAICGLRHEVLKHENTVPPQSMGASSNSEDAFSPGIKQPEAPEITVFFSEKEHL     71 - 140
DLETSEFFRDKKTSYRETALSARKNEKEYDTPEVTLSYSVEKVGCEVPATITYIKDGQRYEELDDSLYLG    141 - 210
KEEYLGSVDTPEDAEATVEEEVYDDPEHVGYDGEEDFENSETTEFSGEEPSYEGSETSLSLEEEQEKSIE    211 - 280
ERKKVFKDVLLCLNMDRSRKVLPDFVKQFSLDRGCKWTPESPGDLAWNFLMKVQARDVTARDSILSHKVL    281 - 350
DEDSKEDLLAGVENLEIRDIQTINPLDVLCATMLCSDSSLQRQVMSNMYQCQFALPLLLPDAENNKSILM    351 - 420
LGAMKDIVKKQSTQFSGGPTEDTEKFLTLMKMPVISFVRLGYCSFSKSRILNTLLSPAQLKLHKIFLHQD    421 - 490
LPLLVLPRQISDGLVEITWCFPDSDDRKENPFFQKPVALANLRGNLESFWTQFGFLMEVSSAVFFFTDCL    491 - 560
GEKEWDLLMFLGEAAIERCYFVLSSQARESEEAQIFQRILNLKPAQLLFWERGDAGDRRKNMEGLQAALQ    561 - 630
EVMFSSCLRCVSVEDMAALARELGIQVDEDFENTQRIQVSSGENMAGTAEGEGQQRHSQLKSSSKSQALM    631 - 700
PIQEPGTQCELSQNLQNLYGTPVFRPVLENSWLFPTRIGGNFNHVSLKASWVMGRPFGSEQRPKWFHPLP    701 - 770
FQNAGAQGRGKSFGIQSFHPQIFYSGERFMKFSRVARGCHSNGTFGRLPRPICQHVQACPERPQMMGTLE    771 - 840
RSRAVASKIGHSYSLDSQPARAVGKPWPQQACTRVTELTEATGKLIRTSHIGKPHPQSFQPAAATQKLRP    841 - 910
ASQQGVQMKTQGGASNPALQIGSHPMCKSSQFKSDQSNPSTVKHSQPKPFHSVPSQPKSSQTKSCQSQPS    911 - 980
QTKPSPCKSTQPKPSQPWPPQSKPSQPRPPQPKSSSTNPSQAKAHHSKAGQKRGGKH                 981 - 1037
//

Text Mined References (9)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20025480 2010 Expression of CARD6, an NF-kappaB activator, in gastric, colorectal and oesophageal cancers.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16582588 2006 CARD tricks: controlling the interactions of CARD6 with RICK and microtubules.
16418290 2006 Caspase recruitment domain protein 6 is a microtubule-interacting protein that positively modulates NF-kappaB activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12775719 2003 CARD6 is a modulator of NF-kappa B activation by Nod1- and Cardiak-mediated pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.