Property Summary

NCBI Gene PubMed Count 7
PubMed Score 8.43
PubTator Score 6.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
active Crohn's disease 2.802 2.2e-03
active ulcerative colitis 3.716 5.4e-03
adult high grade glioma 1.200 1.3e-03
Astrocytoma, Pilocytic 1.600 5.1e-06
Breast cancer -1.400 1.7e-08
breast carcinoma -1.200 1.9e-04
cystic fibrosis 2.556 2.1e-07
fibroadenoma -1.100 1.7e-02
gastric cancer 1.100 6.5e-03
glioblastoma 1.300 2.8e-05
hepatocellular carcinoma 1.900 3.8e-05
intraductal papillary-mucinous adenoma (... 1.600 2.7e-03
intraductal papillary-mucinous neoplasm ... 1.500 1.6e-02
invasive ductal carcinoma -1.400 9.6e-03
lung adenocarcinoma -1.200 9.2e-08
lung carcinoma -2.000 2.9e-29
non-small cell lung cancer -1.177 2.9e-10
osteosarcoma -2.279 2.0e-04
ovarian cancer -1.300 4.3e-06
pancreatic cancer 1.600 2.4e-03
pancreatic carcinoma 1.600 2.4e-03
pituitary cancer -1.500 1.1e-05
psoriasis 1.500 6.0e-42
subependymal giant cell astrocytoma 3.337 5.8e-03

Gene RIF (5)

AA Sequence

MATESTPSEIIERERKKLLEILQHDPDSILDTLTSRRLISEEEYETLENVTDLLKKSRKLLILVQKKGEA      1 - 70
TCQHFLKCLFSTFPQSAAICGLRHEVLKHENTVPPQSMGASSNSEDAFSPGIKQPEAPEITVFFSEKEHL     71 - 140
DLETSEFFRDKKTSYRETALSARKNEKEYDTPEVTLSYSVEKVGCEVPATITYIKDGQRYEELDDSLYLG    141 - 210
KEEYLGSVDTPEDAEATVEEEVYDDPEHVGYDGEEDFENSETTEFSGEEPSYEGSETSLSLEEEQEKSIE    211 - 280
ERKKVFKDVLLCLNMDRSRKVLPDFVKQFSLDRGCKWTPESPGDLAWNFLMKVQARDVTARDSILSHKVL    281 - 350
DEDSKEDLLAGVENLEIRDIQTINPLDVLCATMLCSDSSLQRQVMSNMYQCQFALPLLLPDAENNKSILM    351 - 420
LGAMKDIVKKQSTQFSGGPTEDTEKFLTLMKMPVISFVRLGYCSFSKSRILNTLLSPAQLKLHKIFLHQD    421 - 490
LPLLVLPRQISDGLVEITWCFPDSDDRKENPFFQKPVALANLRGNLESFWTQFGFLMEVSSAVFFFTDCL    491 - 560
GEKEWDLLMFLGEAAIERCYFVLSSQARESEEAQIFQRILNLKPAQLLFWERGDAGDRRKNMEGLQAALQ    561 - 630
EVMFSSCLRCVSVEDMAALARELGIQVDEDFENTQRIQVSSGENMAGTAEGEGQQRHSQLKSSSKSQALM    631 - 700
PIQEPGTQCELSQNLQNLYGTPVFRPVLENSWLFPTRIGGNFNHVSLKASWVMGRPFGSEQRPKWFHPLP    701 - 770
FQNAGAQGRGKSFGIQSFHPQIFYSGERFMKFSRVARGCHSNGTFGRLPRPICQHVQACPERPQMMGTLE    771 - 840
RSRAVASKIGHSYSLDSQPARAVGKPWPQQACTRVTELTEATGKLIRTSHIGKPHPQSFQPAAATQKLRP    841 - 910
ASQQGVQMKTQGGASNPALQIGSHPMCKSSQFKSDQSNPSTVKHSQPKPFHSVPSQPKSSQTKSCQSQPS    911 - 980
QTKPSPCKSTQPKPSQPWPPQSKPSQPRPPQPKSSSTNPSQAKAHHSKAGQKRGGKH                 981 - 1037
//

Text Mined References (10)

PMID Year Title