Property Summary

NCBI Gene PubMed Count 13
Grant Count 4
R01 Count 4
Funding $1,062,613
PubMed Score 2.65
PubTator Score 4.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
psoriasis -1.300 0.000
osteosarcoma -3.518 0.000

Synonym

Accession Q9BWX1 K4DI82
Symbols HSPC045
HSPC226
NYD-SP6

Gene

Gene RIF (1)

PMID Text
22894908 PHF7 promoter binds H4K12ac in mature spermatozoa.

AA Sequence

MKTVKEKKECQRLRKSAKTRRVTQRKPSSGPVCWLCLREPGDPEKLGEFLQKDNISVHYFCLILSSKLPQ      1 - 70
RGQSNRGFHGFLPEDIKKEAARASRKICFVCKKKGAAINCQKDQCLRNFHLPCGQERGCLSQFFGEYKSF     71 - 140
CDKHRPTQNIQHGHVGEESCILCCEDLSQQSVENIQSPCCSQAIYHRKCIQKYAHTSAKHFFKCPQCNNR    141 - 210
KEFPQEMLRMGIHIPDRDAAWELEPGAFSDLYQRYQHCDAPICLYEQGRDSFEDEGRWCLILCATCGSHG    211 - 280
THRDCSSLRSNSKKWECEECSPAAATDYIPENSGDIPCCSSTFHPEEHFCRDNTLEENPGLSWTDWPEPS    281 - 350
LLEKPESSRGRRSYSWRSKGVRITNSCKKSK                                           351 - 381
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
22894908 2012 Genome wide identification of promoter binding sites for H4K12ac in human sperm and its relevance for early embryonic development.
22595675 2012 Phf7 controls male sex determination in the Drosophila germline.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21630459 2011 Proteomic characterization of the human sperm nucleus.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...