Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.45
PubTator Score 4.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 8.7e-11
malignant mesothelioma 3232 1.8e-05
psoriasis 6694 2.4e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Polycystic kidney disease 1 21 3.95 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.100 1.8e-05
osteosarcoma -3.518 8.7e-11
psoriasis -1.300 2.4e-04

Synonym

Accession Q9BWX1 K4DI82
Symbols HSPC045
HSPC226
NYD-SP6

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MKTVKEKKECQRLRKSAKTRRVTQRKPSSGPVCWLCLREPGDPEKLGEFLQKDNISVHYFCLILSSKLPQ      1 - 70
RGQSNRGFHGFLPEDIKKEAARASRKICFVCKKKGAAINCQKDQCLRNFHLPCGQERGCLSQFFGEYKSF     71 - 140
CDKHRPTQNIQHGHVGEESCILCCEDLSQQSVENIQSPCCSQAIYHRKCIQKYAHTSAKHFFKCPQCNNR    141 - 210
KEFPQEMLRMGIHIPDRDAAWELEPGAFSDLYQRYQHCDAPICLYEQGRDSFEDEGRWCLILCATCGSHG    211 - 280
THRDCSSLRSNSKKWECEECSPAAATDYIPENSGDIPCCSSTFHPEEHFCRDNTLEENPGLSWTDWPEPS    281 - 350
LLEKPESSRGRRSYSWRSKGVRITNSCKKSK                                           351 - 381
//

Text Mined References (15)

PMID Year Title