Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.24
PubTator Score 5.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Influenza 142
Disease Target Count P-value
psoriasis 6685 5.25099892263675E-11
lung carcinoma 2844 1.26053603991889E-10
cutaneous lupus erythematosus 1056 1.17910637201818E-5
adult high grade glioma 2148 5.16791817030679E-5
ulcerative colitis 2087 6.14901214516947E-5
tuberculosis 1563 2.09446535767405E-4
primary Sjogren syndrome 789 2.5181359598557E-4
pilocytic astrocytoma 3086 2.76724829228678E-4
glioblastoma 5572 3.0985804497706E-4
osteosarcoma 7933 3.40571095449213E-4
breast carcinoma 1614 6.10784417284463E-4
ductal carcinoma in situ 1745 9.59114907986269E-4
lung cancer 4473 0.00131185042822809
Atopic dermatitis 944 0.00234738130164095
invasive ductal carcinoma 2950 0.00335317317765105
Multiple Sclerosis 498 0.00458331198402897
interstitial cystitis 2299 0.0124810039850155
head and neck cancer 270 0.0135148850658413
non-inflammatory breast cancer 208 0.0144704240540166
colon cancer 1475 0.0149123853597692
fibroadenoma 557 0.0222760400710323
chronic rhinosinusitis 512 0.0224677830844277
subependymal giant cell astrocytoma 2287 0.0302540116886631
active Crohn's disease 918 0.0302659055184794
cystic fibrosis and chronic rhinosinusitis 213 0.0437564355503935
Disease Target Count Z-score Confidence
Chikungunya 12 3.543 1.8

Expression

  Differential Expression (25)

Disease log2 FC p
psoriasis 2.000 0.000
cutaneous lupus erythematosus 3.600 0.000
osteosarcoma -2.267 0.000
glioblastoma 1.200 0.000
Atopic dermatitis 1.200 0.002
tuberculosis 1.100 0.000
colon cancer -1.700 0.015
lung cancer -2.300 0.001
active Crohn's disease 1.493 0.030
breast carcinoma -1.500 0.001
fibroadenoma -1.900 0.022
Multiple Sclerosis 1.100 0.005
interstitial cystitis 1.200 0.012
adult high grade glioma 1.600 0.000
pilocytic astrocytoma 1.400 0.000
primary Sjogren syndrome 1.300 0.000
subependymal giant cell astrocytoma 1.805 0.030
non-inflammatory breast cancer 1.600 0.014
lung carcinoma -1.100 0.000
ductal carcinoma in situ -1.800 0.001
invasive ductal carcinoma -1.800 0.003
ulcerative colitis 2.000 0.000
chronic rhinosinusitis 1.962 0.022
cystic fibrosis and chronic rhinosinusit... 1.728 0.044
head and neck cancer 1.300 0.014

Synonym

Accession Q9BWW8 Q5R3S1 Q658J1 Q8IXX6 Q9UGG1
Symbols APOLVI
APOL-VI

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Dog OMA Inparanoid
Pig OMA Inparanoid

Gene RIF (7)

PMID Text
25980612 Infectious wild type HIV-1 production is restricted by 293T cells over-expressing APOL6
23911300 Polymorphisms in FABP2 and APOL6, located at the predicted miRNAs binding sites, are identified to contribute to susceptibility to MetS in the Chinese Han population.
22632162 Both HIV-1 Tat 47-59 and FITC-labeled Tat 47-59 peptides upregulate gene expression of apolipoprotein L, 6 (APOL6) in U-937 macrophages
21646352 results suggest that ApoL6 regulates both apoptosis and autophagy in SMCs. IFNgamma-initiated, ApoL6-induced apoptosis in vascular cells may be an important factor causing plaque instability
18571626 Observational study of gene-disease association. (HuGE Navigator)
15671246 Apolipoprotein l6 is a novel proapoptotic Bcl-2 homology 3-only protein that induces mitochondria-mediated apoptosis in cancer cells
11374903 APOL6 has been found only in humans

AA Sequence

MDNQAERESEAGVGLQRDEDDAPLCEDVELQDGDLSPEEKIFLREFPRLKEDLKGNIDKLRALADDIDKT      1 - 70
HKKFTKANMVATSTAVISGVMSLLGLALAPATGGGSLLLSTAGQGLATAAGVTSIVSGTLERSKNKEAQA     71 - 140
RAEDILPTYDQEDREDEEEKADYVTAAGKIIYNLRNTLKYAKKNVRAFWKLRANPRLANATKRLLTTGQV    141 - 210
SSRSRVQVQKAFAGTTLAMTKNARVLGGVMSAFSLGYDLATLSKEWKHLKEGARTKFAEELRAKALELER    211 - 280
KLTELTQLYKSLQQKVRSRARGVGKDLTGTCETEAYWKELREHVWMWLWLCVCLCVCVYVQFT           281 - 343
//

Text Mined References (15)

PMID Year Title
23911300 2013 Polymorphisms in lipid metabolism related miRNA binding sites and risk of metabolic syndrome.
21646352 2011 Apolipoprotein L6, induced in atherosclerotic lesions, promotes apoptosis and blocks Beclin 1-dependent autophagy in atherosclerotic cells.
19299565 2009 The apolipoprotein L family of programmed cell death and immunity genes rapidly evolved in primates at discrete sites of host-pathogen interactions.
18571626 2008 RASD2, MYH9, and CACNG2 genes at chromosome 22q12 associated with the subgroup of schizophrenia with non-deficit in sustained attention and executive function.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15671246 2005 Apolipoprotein l6, a novel proapoptotic Bcl-2 homology 3-only protein, induces mitochondria-mediated apoptosis in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...