Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.46
PubTator Score 5.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
active Crohn's disease 1.010 4.2e-03
adult high grade glioma 1.600 5.2e-05
Astrocytoma, Pilocytic 1.300 5.0e-09
Atopic dermatitis 1.200 2.3e-03
breast carcinoma -1.500 6.1e-04
chronic rhinosinusitis 1.962 2.2e-02
colon cancer -1.700 1.5e-02
cutaneous lupus erythematosus 3.600 1.2e-05
cystic fibrosis and chronic rhinosinusit... 1.728 4.4e-02
ductal carcinoma in situ -1.800 9.6e-04
fibroadenoma -1.900 2.2e-02
glioblastoma 1.200 3.1e-04
head and neck cancer 1.300 1.4e-02
interstitial cystitis 1.200 1.2e-02
invasive ductal carcinoma -1.800 3.4e-03
lung cancer -2.200 3.4e-04
lung carcinoma -1.100 1.3e-10
Multiple Sclerosis 1.100 4.6e-03
non-inflammatory breast cancer 1.600 1.4e-02
osteosarcoma -2.267 3.4e-04
primary Sjogren syndrome 1.300 2.5e-04
psoriasis 1.100 5.7e-07
subependymal giant cell astrocytoma 1.805 3.0e-02
tuberculosis 1.100 2.1e-04
ulcerative colitis 1.300 5.6e-06

Synonym

Accession Q9BWW8 Q5R3S1 Q658J1 Q8IXX6 Q9UGG1
Symbols APOLVI
APOL-VI

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (7)

AA Sequence

MDNQAERESEAGVGLQRDEDDAPLCEDVELQDGDLSPEEKIFLREFPRLKEDLKGNIDKLRALADDIDKT      1 - 70
HKKFTKANMVATSTAVISGVMSLLGLALAPATGGGSLLLSTAGQGLATAAGVTSIVSGTLERSKNKEAQA     71 - 140
RAEDILPTYDQEDREDEEEKADYVTAAGKIIYNLRNTLKYAKKNVRAFWKLRANPRLANATKRLLTTGQV    141 - 210
SSRSRVQVQKAFAGTTLAMTKNARVLGGVMSAFSLGYDLATLSKEWKHLKEGARTKFAEELRAKALELER    211 - 280
KLTELTQLYKSLQQKVRSRARGVGKDLTGTCETEAYWKELREHVWMWLWLCVCLCVCVYVQFT           281 - 343
//

Text Mined References (15)

PMID Year Title