Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.46
PubTator Score 3.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.700 1.5e-02
atypical teratoid / rhabdoid tumor 2.500 3.2e-07
COPD -1.400 1.3e-03
ependymoma 1.900 2.9e-02
glioblastoma 2.100 1.5e-04
group 4 medulloblastoma 2.200 1.4e-03
medulloblastoma, large-cell 2.000 2.5e-04
oligodendroglioma 2.000 1.5e-02
osteosarcoma -1.320 2.3e-04
pediatric high grade glioma 1.300 8.3e-03
primitive neuroectodermal tumor 1.600 4.5e-04
Rheumatoid arthritis -1.300 3.5e-02

Gene RIF (3)

AA Sequence

MDLPGDSSPPGQPRLCRQPLTRALWGARSPKRPRLQLPGAPSPLEKASRRVLAVVLEDVMAVHMVPVVPS      1 - 70
KQTSIPQHHSYHQDPVHRQPPASPPRQAGWSSQARPPDPLCLCREPLSRIHRTSSTLRRRSRTTPGPEEG     71 - 140
PSQKVDRAPQPTLVVMLEDIASPRPPAEGFIDETPNFIIPAQRAEPMRIVRQPTPPPGDLEPPFQPSALP    141 - 210
ADPLESPPTAPDPALELPSTPPPSSLLRPRLSPWGLAPLFRSVRSKLESFADIFLTPNKTPQPPPPSPPM    211 - 280
KLELKIAISEAEQSGAAEGTASVSPRPPIRQWRTQDHNTPALLPKPSLGRSYSCPDLGPPGPGTCTWPPA    281 - 350
PPQPSRPRPRRHTVGGGEMARAPPPPRPCLRKEVFPLGGVGASPSLTTSCSSTASTSFSEPAEPRLGSTK    351 - 420
GKEPRASKDQVLSEPETKTMGKVSRFRIRRTPARPQLNLTPMGLPRPIRLNKKEFSLEEIYTNKNYQSPT    421 - 490
TRRTFETIFEEPRERNGTLIFTSSRKLRRAVEFRDSSLPRSRRPSRGVRAAGGRTVPPNVAPSPDVGPLL    491 - 560
QQRLEELDALLLEEETVDREQPHWT                                                 561 - 585
//

Text Mined References (14)

PMID Year Title