Property Summary

NCBI Gene PubMed Count 7
PubMed Score 6.46
PubTator Score 3.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis -1.300 0.035
astrocytic glioma 1.700 0.015
ependymoma 1.900 0.029
oligodendroglioma 2.000 0.015
osteosarcoma -1.320 0.000
atypical teratoid / rhabdoid tumor 2.500 0.000
glioblastoma 2.100 0.000
group 4 medulloblastoma 2.200 0.001
medulloblastoma, large-cell 2.000 0.000
primitive neuroectodermal tumor 1.600 0.000
pediatric high grade glioma 1.300 0.008
COPD -1.400 0.001

Gene RIF (2)

PMID Text
25906157 The results altogether support a model in which PRR14 promotes skeletal myogenesis via supporting nuclear lamina structure and enhancing the activity of MyoD.
24209742 The stepwise reassembly of PRR14 suggests a function in the selection of heterochromatin protein 1-bound heterochromatin for reattachment to the nuclear lamina as cells exit mitosis.

AA Sequence

MDLPGDSSPPGQPRLCRQPLTRALWGARSPKRPRLQLPGAPSPLEKASRRVLAVVLEDVMAVHMVPVVPS      1 - 70
KQTSIPQHHSYHQDPVHRQPPASPPRQAGWSSQARPPDPLCLCREPLSRIHRTSSTLRRRSRTTPGPEEG     71 - 140
PSQKVDRAPQPTLVVMLEDIASPRPPAEGFIDETPNFIIPAQRAEPMRIVRQPTPPPGDLEPPFQPSALP    141 - 210
ADPLESPPTAPDPALELPSTPPPSSLLRPRLSPWGLAPLFRSVRSKLESFADIFLTPNKTPQPPPPSPPM    211 - 280
KLELKIAISEAEQSGAAEGTASVSPRPPIRQWRTQDHNTPALLPKPSLGRSYSCPDLGPPGPGTCTWPPA    281 - 350
PPQPSRPRPRRHTVGGGEMARAPPPPRPCLRKEVFPLGGVGASPSLTTSCSSTASTSFSEPAEPRLGSTK    351 - 420
GKEPRASKDQVLSEPETKTMGKVSRFRIRRTPARPQLNLTPMGLPRPIRLNKKEFSLEEIYTNKNYQSPT    421 - 490
TRRTFETIFEEPRERNGTLIFTSSRKLRRAVEFRDSSLPRSRRPSRGVRAAGGRTVPPNVAPSPDVGPLL    491 - 560
QQRLEELDALLLEEETVDREQPHWT                                                 561 - 585
//

Text Mined References (12)

PMID Year Title
25906157 2015 A novel role of PRR14 in the regulation of skeletal myogenesis.
24637393 Specifying peripheral heterochromatin during nuclear lamina reassembly.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24209742 2013 The human protein PRR14 tethers heterochromatin to the nuclear lamina during interphase and mitotic exit.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20562864 2010 Human POGZ modulates dissociation of HP1alpha from mitotic chromosome arms through Aurora B activation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...