Property Summary

NCBI Gene PubMed Count 7
PubMed Score 6.46
PubTator Score 3.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 3.20718644613453E-7
glioblastoma 5572 1.53184479031977E-4
osteosarcoma 7933 2.33807457180313E-4
medulloblastoma, large-cell 6234 2.49715751722501E-4
primitive neuroectodermal tumor 3031 4.48853831037584E-4
COPD 116 0.00125648682435106
group 4 medulloblastoma 1875 0.00141424131339903
pediatric high grade glioma 2712 0.00833863505795572
astrocytic glioma 2241 0.0154185590259511
oligodendroglioma 2849 0.0154397450143319
ependymoma 2514 0.0287354255083322
Rheumatoid Arthritis 1171 0.0349733209540666
Disease Target Count Z-score Confidence
systemic lupus erythematosus 172 0.0 2.0

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis -1.300 0.035
astrocytic glioma 1.700 0.015
ependymoma 1.900 0.029
oligodendroglioma 2.000 0.015
osteosarcoma -1.320 0.000
atypical teratoid / rhabdoid tumor 2.500 0.000
glioblastoma 2.100 0.000
group 4 medulloblastoma 2.200 0.001
medulloblastoma, large-cell 2.000 0.000
primitive neuroectodermal tumor 1.600 0.000
pediatric high grade glioma 1.300 0.008
COPD -1.400 0.001

Synonym

Accession Q9BWN1 Q8WTX2
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG

Gene RIF (2)

PMID Text
25906157 The results altogether support a model in which PRR14 promotes skeletal myogenesis via supporting nuclear lamina structure and enhancing the activity of MyoD.
24209742 The stepwise reassembly of PRR14 suggests a function in the selection of heterochromatin protein 1-bound heterochromatin for reattachment to the nuclear lamina as cells exit mitosis.

AA Sequence

MDLPGDSSPPGQPRLCRQPLTRALWGARSPKRPRLQLPGAPSPLEKASRRVLAVVLEDVMAVHMVPVVPS      1 - 70
KQTSIPQHHSYHQDPVHRQPPASPPRQAGWSSQARPPDPLCLCREPLSRIHRTSSTLRRRSRTTPGPEEG     71 - 140
PSQKVDRAPQPTLVVMLEDIASPRPPAEGFIDETPNFIIPAQRAEPMRIVRQPTPPPGDLEPPFQPSALP    141 - 210
ADPLESPPTAPDPALELPSTPPPSSLLRPRLSPWGLAPLFRSVRSKLESFADIFLTPNKTPQPPPPSPPM    211 - 280
KLELKIAISEAEQSGAAEGTASVSPRPPIRQWRTQDHNTPALLPKPSLGRSYSCPDLGPPGPGTCTWPPA    281 - 350
PPQPSRPRPRRHTVGGGEMARAPPPPRPCLRKEVFPLGGVGASPSLTTSCSSTASTSFSEPAEPRLGSTK    351 - 420
GKEPRASKDQVLSEPETKTMGKVSRFRIRRTPARPQLNLTPMGLPRPIRLNKKEFSLEEIYTNKNYQSPT    421 - 490
TRRTFETIFEEPRERNGTLIFTSSRKLRRAVEFRDSSLPRSRRPSRGVRAAGGRTVPPNVAPSPDVGPLL    491 - 560
QQRLEELDALLLEEETVDREQPHWT                                                 561 - 585
//

Text Mined References (12)

PMID Year Title
25906157 2015 A novel role of PRR14 in the regulation of skeletal myogenesis.
24637393 Specifying peripheral heterochromatin during nuclear lamina reassembly.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24209742 2013 The human protein PRR14 tethers heterochromatin to the nuclear lamina during interphase and mitotic exit.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20562864 2010 Human POGZ modulates dissociation of HP1alpha from mitotic chromosome arms through Aurora B activation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...