Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8519 9.4e-12
malignant mesothelioma 3232 6.8e-06
Disease Target Count Z-score Confidence
Uveal melanoma 20 3.097 1.5

Expression

Synonym

Accession Q9BWJ2
Symbols C8orf51

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MPAFFSLPAERRLQAWPQSEAPLSVSSCFQNRPPEPASFQNLRPEPASLQNLRTEPTSF                 1 - 59
//

Text Mined References (7)

PMID Year Title