Property Summary

NCBI Gene PubMed Count 23
Grant Count 4
R01 Count 4
Funding $366,669.5
PubMed Score 16.90
PubTator Score 120.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.700 0.000
lung adenocarcinoma 1.300 0.000

Synonym

Accession Q9BWF2 B5BU84 B5BUL3 O00467
Symbols TRIP
SCKL9
RNF206

Gene

PANTHER Protein Class (2)

PDB

4ZTD  

Gene RIF (14)

PMID Text
26820530 Taken together, these findings improve the understanding clinical implication of TRAIP in various diseases including primordial dwarfism and cancers.
26781088 TRAIP/RNF206 is required for recruitment of RAP80 to sites of DNA damage.(
26711499 These findings establish TRAIP as a PCNA-binding ubiquitin ligase with an important role in protecting genome integrity after obstacles to DNA replication.
26595769 TRAIP is a component of the DNA damage response to replication-blocking DNA lesions.TRAIP promotes DNA damage response during genome replication and is mutated in primordial dwarfism.
26369285 cell cycle-dependent transcription of the TRAIP gene by E2F1, E2F2, and E2F4 and rapid protein degradation leads to cell cycle-dependent expression with a maximum in G2/M
26093298 a number of TRAIP mutants were used to define the TRAIP molecular domains responsible for its homo-dimerization. A co-immunoprecipitation assay indicated that the TRAIP forms homo-dimerization through the CC domain
25716317 Data indicate that TRAF interacting protein TRIP negatively regulates the TNFR-associated factor 2 (TRAF2) ubiquitin-dependent pathway by modulating the TRAF2-sphingosine 1-phosphate (S1P) interaction.
25335891 The TRAIP ubiquitin ligase activity is functionally required for the spindle assembly checkpoint control.
24553286 observed enhanced ubiquitylation of Poleta by TRIP E3 ligase and show that TRIP promotes Poleta localization to nuclear foci
21068752 The TRAF-interacting protein (TRIP) is a regulator of keratinocyte proliferation.
More...

AA Sequence

MPIRALCTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRIQVGKRTIINKLFFDLAQEE      1 - 70
ENVLDAEFLKNELDNVRAQLSQKDKEKRDSQVIIDTLRDTLEERNATVVSLQQALGKAEMLCSTLKKQMK     71 - 140
YLEQQQDETKQAQEEARRLRSKMKTMEQIELLLQSQRPEVEEMIRDMGVGQSAVEQLAVYCVSLKKEYEN    141 - 210
LKEARKASGEVADKLRKDLFSSRSKLQTVYSELDQAKLELKSAQKDLQSADKEIMSLKKKLTMLQETLNL    211 - 280
PPVASETVDRLVLESPAPVEVNLKLRRPSFRDDIDLNATFDVDTPPARPSSSQHGYYEKLCLEKSHSPIQ    281 - 350
DVPKKICKGPRKESQLSLGGQSCAGEPDEELVGAFPIFVRNAILGQKQPKRPRSESSCSKDVVRTGFDGL    351 - 420
GGRTKFIQPTDTVMIRPLPVKPKTKVKQRVRVKTVPSLFQAKLDTFLWS                         421 - 469
//

Text Mined References (25)

PMID Year Title
26820530 2016 SUMOylation regulates nuclear localization and stability of TRAIP/RNF206.
26781088 2016 TRAIP/RNF206 is required for recruitment of RAP80 to sites of DNA damage.
26711499 2016 TRAIP is a PCNA-binding ubiquitin ligase that protects genome stability after replication stress.
26595769 2016 TRAIP promotes DNA damage response during genome replication and is mutated in primordial dwarfism.
26369285 2015 The TRAF-interacting protein (TRAIP) is a novel E2F target with peak expression in mitosis.
26093298 2015 Dimerization of TRAF-interacting protein (TRAIP) regulates the mitotic progression.
25716317 2015 Tumor necrosis factor (TNF) receptor-associated factor (TRAF)-interacting protein (TRIP) negatively regulates the TRAF2 ubiquitin-dependent pathway by suppressing the TRAF2-sphingosine 1-phosphate (S1P) interaction.
25416956 2014 A proteome-scale map of the human interactome network.
25335891 2014 TRAIP is a regulator of the spindle assembly checkpoint.
24553286 2014 TRIP/NOPO E3 ubiquitin ligase promotes ubiquitylation of DNA polymerase ?.
More...