Property Summary

NCBI Gene PubMed Count 43
PubMed Score 52.60
PubTator Score 58.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.100 7.4e-03
Hydrolethalus syndrome -1.904 6.7e-03
malignant mesothelioma 1.900 3.0e-07
pancreatic ductal adenocarcinoma liver m... -1.911 5.2e-03

Protein-protein Interaction (1)

Gene RIF (27)

AA Sequence

MNAGSDPVVIVSAARTIIGSFNGALAAVPVQDLGSTVIKEVLKRATVAPEDVSEVIFGHVLAAGCGQNPV      1 - 70
RQASVGAGIPYSVPAWSCQMICGSGLKAVCLAVQSIGIGDSSIVVAGGMENMSKAPHLAYLRTGVKIGEM     71 - 140
PLTDSILCDGLTDAFHNCHMGITAENVAKKWQVSREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTR    141 - 210
KGLIEVKTDEFPRHGSNIEAMSKLKPYFLTDGTGTVTPANASGINDGAAAVVLMKKSEADKRGLTPLARI    211 - 280
VSWSQVGVEPSIMGIGPIPAIKQAVTKAGWSLEDVDIFEINEAFAAVSAAIVKELGLNPEKVNIEGGAIA    281 - 350
LGHPLGASGCRILVTLLHTLERMGRSRGVAALCIGGGMGIAMCVQRE                           351 - 397
//

Text Mined References (50)

PMID Year Title