Property Summary

NCBI Gene PubMed Count 39
Grant Count 37
R01 Count 20
Funding $9,423,731.37
PubMed Score 52.82
PubTator Score 58.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Gene RIF (23)

PMID Text
25917363 results show that the enzymatic activity of mutant Glu(14)Gly is approximately two times higher than wildtype, and that this increase is primarily due to the increased expression and/or stability of the mutant ACAT2 protein
25042803 Results show that DLAT and ACAT2 as upstream acetyltransferases of K76 and K294 in 6PGD protein.
22155889 HNF4alpha positively regulates ACAT2 gene expression at mRNA level. Overexpression of HNF4alpha increased ACAT2 expression, whereas knockdown of HNF4alpha decreased ACAT2 expression.
21987487 Reduced ACAT2 is associated with impaired butyrate oxidation in ulcerative colitis.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20167577 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19467657 Describe a gender-related difference in hepatic ACAT2 activity in normolipidemic non-obese Chinese patients suggesting a possible role for ACAT2 in the regulation of cholesterol metabolism in humans.
More...

AA Sequence

MNAGSDPVVIVSAARTIIGSFNGALAAVPVQDLGSTVIKEVLKRATVAPEDVSEVIFGHVLAAGCGQNPV      1 - 70
RQASVGAGIPYSVPAWSCQMICGSGLKAVCLAVQSIGIGDSSIVVAGGMENMSKAPHLAYLRTGVKIGEM     71 - 140
PLTDSILCDGLTDAFHNCHMGITAENVAKKWQVSREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTR    141 - 210
KGLIEVKTDEFPRHGSNIEAMSKLKPYFLTDGTGTVTPANASGINDGAAAVVLMKKSEADKRGLTPLARI    211 - 280
VSWSQVGVEPSIMGIGPIPAIKQAVTKAGWSLEDVDIFEINEAFAAVSAAIVKELGLNPEKVNIEGGAIA    281 - 350
LGHPLGASGCRILVTLLHTLERMGRSRGVAALCIGGGMGIAMCVQRE                           351 - 397
//

Text Mined References (46)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25917363 2015 Functional characterization of two single nucleotide polymorphisms of acyl-coenzyme A:cholesterol acyltransferase 2.
25416956 2014 A proteome-scale map of the human interactome network.
25042803 2014 Lysine acetylation activates 6-phosphogluconate dehydrogenase to promote tumor growth.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22155889 2012 Two novel cis-elements involved in hepatocyte nuclear factor 4? regulation of acyl-coenzyme A:cholesterol acyltransferase 2 expression.
21987487 2012 Impaired butyrate oxidation in ulcerative colitis is due to decreased butyrate uptake and a defect in the oxidation pathway.
More...