Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.58
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 5.5e-05

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.158 5.5e-05

AA Sequence

MSERKVLNKYYPPDFDPSKIPKLKLPKDRQYVVRLMAPFNMRCKTCGEYIYKGKKFNARKETVQNEVYLG      1 - 70
LPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQAEKLLEEEEKRVQKEREDEELNNPMKVLENR     71 - 140
TKDSKLEMEVLENLQELKDLNQRQAHVDFEAMLRQHRLSEEERRRQQQEEDEQETAALLEEARKRRLLED    141 - 210
SDSEDEAAPSPLQPALRPNPTAILDEAPKPKRKVEVWEQSVGSLGSRPPLSRLVVVKKAKADPDCSNGQP    211 - 280
QAAPTPGAPQNRKEANPTPLTPGASSLSQLGAYLDSDDSNGSN                               281 - 323
//

Text Mined References (13)

PMID Year Title