Property Summary

NCBI Gene PubMed Count 16
Grant Count 22
R01 Count 7
Funding $1,510,335.64
PubMed Score 14.89
PubTator Score 9.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
astrocytic glioma 1.300 0.008
ependymoma 2.200 0.008
oligodendroglioma 1.400 0.014
psoriasis -1.200 0.010
osteosarcoma -1.267 0.000
medulloblastoma 1.100 0.000
tuberculosis 1.400 0.000
lung cancer -1.100 0.001

Gene RIF (1)

PMID Text
24488770 Study coupled human genetics with functional validation in zebrafish and identified IFT27 as a novel BBS gene (BBS19).

AA Sequence

MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKEL      1 - 70
FSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARA     71 - 140
WALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA                            141 - 186
//

Text Mined References (16)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
25443296 2014 The intraflagellar transport protein IFT27 promotes BBSome exit from cilia through the GTPase ARL6/BBS3.
25416956 2014 A proteome-scale map of the human interactome network.
24488770 2014 IFT27, encoding a small GTPase component of IFT particles, is mutated in a consanguineous family with Bardet-Biedl syndrome.
22022256 2011 Thousands of rab GTPases for the cell biologist.
21269460 2011 Initial characterization of the human central proteome.
17276912 2007 Intraflagellar transport protein 27 is a small G protein involved in cell-cycle control.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...