Property Summary

NCBI Gene PubMed Count 16
PubMed Score 14.89
PubTator Score 9.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
tuberculosis 1563 2.89168131920524E-7
malignant mesothelioma 3163 7.45956869013817E-6
medulloblastoma 1524 1.67117133456253E-4
osteosarcoma 7933 3.53742487724342E-4
lung cancer 4473 0.00128474112280402
astrocytic glioma 2241 0.00759806947700612
ependymoma 2514 0.00840301352001409
psoriasis 6685 0.00966284021306414
oligodendroglioma 2849 0.0135432497421935
Disease Target Count Z-score Confidence
Obesity 616 0.0 4.0
Disease Target Count Z-score Confidence
Ciliopathy 57 3.577 1.8
cone-rod dystrophy 60 3.226 1.6
Retinitis pigmentosa 156 3.035 1.5

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
astrocytic glioma 1.300 0.008
ependymoma 2.200 0.008
oligodendroglioma 1.400 0.014
psoriasis -1.200 0.010
osteosarcoma -1.267 0.000
medulloblastoma 1.100 0.000
tuberculosis 1.400 0.000
lung cancer -1.100 0.001

Synonym

Accession Q9BW83 O60897
Symbols RAYL
BBS19
RABL4

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (1)

PMID Text
24488770 Study coupled human genetics with functional validation in zebrafish and identified IFT27 as a novel BBS gene (BBS19).

AA Sequence

MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKEL      1 - 70
FSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARA     71 - 140
WALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA                            141 - 186
//

Text Mined References (16)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
25443296 2014 The intraflagellar transport protein IFT27 promotes BBSome exit from cilia through the GTPase ARL6/BBS3.
25416956 2014 A proteome-scale map of the human interactome network.
24488770 2014 IFT27, encoding a small GTPase component of IFT particles, is mutated in a consanguineous family with Bardet-Biedl syndrome.
22022256 2011 Thousands of rab GTPases for the cell biologist.
21269460 2011 Initial characterization of the human central proteome.
17276912 2007 Intraflagellar transport protein 27 is a small G protein involved in cell-cycle control.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...