Property Summary

NCBI Gene PubMed Count 17
PubMed Score 16.55
PubTator Score 9.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.300 7.6e-03
ependymoma 2.200 8.4e-03
lung cancer -1.100 1.3e-03
malignant mesothelioma -1.200 7.5e-06
medulloblastoma 1.100 1.7e-04
oligodendroglioma 1.400 1.4e-02
osteosarcoma -1.267 3.5e-04
psoriasis -1.200 9.7e-03
tuberculosis 1.400 2.9e-07

Gene RIF (1)

AA Sequence

MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKEL      1 - 70
FSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARA     71 - 140
WALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA                            141 - 186
//

Text Mined References (17)

PMID Year Title