Property Summary

NCBI Gene PubMed Count 7
Grant Count 2
Funding $19,687.5
PubMed Score 8.78
PubTator Score 7.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Rheumatoid Arthritis -1.300 0.003
astrocytic glioma -1.600 0.012
psoriasis -2.200 0.000

Gene RIF (3)

PMID Text
22190034 HIV-1 Vpr is identified to have a physical interaction with DET1 and DDB1 associated 1 (DDA1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
19295130 Cells depleted of Dda1 spontaneously accumulated double-stranded DNA breaks in a similar way to Cul4A-, Cul4B- or Wdr23-depleted cells, indicating that Dda1 interacts physically and functionally with cullin-RING E3 ligases complexes.
17557237 PCIA1 gene expression correlates with tumor formation, invasion and metastasis

AA Sequence

MADFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWDKKNAAK      1 - 70
KRDQEQVELEGESSAPPRKVARTDSPDMHEDT                                           71 - 102
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23273568 2013 Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19295130 2009 An interaction network of the mammalian COP9 signalosome identifies Dda1 as a core subunit of multiple Cul4-based E3 ligases.
More...