Property Summary

NCBI Gene PubMed Count 10
PubMed Score 9.33
PubTator Score 7.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.5e-05
Rheumatoid arthritis 1191 3.3e-03
astrocytic glioma 2597 1.2e-02
Disease Target Count Z-score Confidence
Systemic lupus erythematosus 194 0.0 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytic glioma -1.600 1.2e-02
psoriasis -2.200 3.5e-05
Rheumatoid arthritis -1.300 3.3e-03

Synonym

Accession Q9BW61
Symbols PCIA1
C19orf58

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (5)

AA Sequence

MADFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWDKKNAAK      1 - 70
KRDQEQVELEGESSAPPRKVARTDSPDMHEDT                                           71 - 102
//

Text Mined References (18)

PMID Year Title