Property Summary

NCBI Gene PubMed Count 16
Grant Count 36
R01 Count 30
Funding $2,143,121.15
PubMed Score 13.92
PubTator Score 26.62

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
25499606 ELOV1 promotes very long-chain fatty acid accumulation X-linked adrenoleukodystrophy and is inhibited by CoA esters of bezafibrate and gemfibrozil.
24489110 Results suggest that inhibition of atty acid elongase 1 (ELOVL1) may be an underlying mechanism by which Lorenzo's oil exerts its action.
23538298 down-regulation of ELOVL1 had a comprehensive effect on the synthesis of very long chain ceramides which possibly point to a requirement for ELOVL1 expression for full CerS2-activity.
20937905 ELOVL1 activity is regulated with the ceramide synthase CERS2, an enzyme essential for C24 sphingolipid synthesis.
20166112 The authors identify ELOVL1 (elongation of very-long-chain-fatty acids) as the single elongase catalysing the synthesis of both saturated VLCFA (C26:0) and mono-unsaturated VLCFA (C26:1).

AA Sequence

MEAVVNLYQEVMKHADPRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLV      1 - 70
ALSLYIVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMVRVAWLFLFSKFIELMDTVIFILRKKDGQVTFL     71 - 140
HVFHHSVLPWSWWWGVKIAPGGMGSFHAMINSSVHVIMYLYYGLSAFGPVAQPYLWWKKHMTAIQLIQFV    141 - 210
LVSLHISQYYFMSSCNYQYPVIIHLIWMYGTIFFMLFSNFWYHSYTKGKRLPRALQQNGAPGIAKVKAN     211 - 279
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25499606 2015 Enzymatic characterization of ELOVL1, a key enzyme in very long-chain fatty acid synthesis.
24489110 2014 Lorenzo's oil inhibits ELOVL1 and lowers the level of sphingomyelin with a saturated very long-chain fatty acid.
23538298 2013 The equilibrium between long and very long chain ceramides is important for the fate of the cell and can be influenced by co-expression of CerS.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
20937905 2010 ELOVL1 production of C24 acyl-CoAs is linked to C24 sphingolipid synthesis.
20166112 2010 The role of ELOVL1 in very long-chain fatty acid homeostasis and X-linked adrenoleukodystrophy.
19946888 2010 Defining the membrane proteome of NK cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
More...