Property Summary

NCBI Gene PubMed Count 16
PubMed Score 13.92
PubTator Score 26.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Expression

Synonym

Accession Q9BW60 B4DP24 Q53HT2 Q5JUY3 Q8WXU3 Q9NVD9 Q9Y396
Symbols Ssc1
CGI-88

Gene

PANTHER Protein Class (2)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (5)

PMID Text
25499606 ELOV1 promotes very long-chain fatty acid accumulation X-linked adrenoleukodystrophy and is inhibited by CoA esters of bezafibrate and gemfibrozil.
24489110 Results suggest that inhibition of atty acid elongase 1 (ELOVL1) may be an underlying mechanism by which Lorenzo's oil exerts its action.
23538298 down-regulation of ELOVL1 had a comprehensive effect on the synthesis of very long chain ceramides which possibly point to a requirement for ELOVL1 expression for full CerS2-activity.
20937905 ELOVL1 activity is regulated with the ceramide synthase CERS2, an enzyme essential for C24 sphingolipid synthesis.
20166112 The authors identify ELOVL1 (elongation of very-long-chain-fatty acids) as the single elongase catalysing the synthesis of both saturated VLCFA (C26:0) and mono-unsaturated VLCFA (C26:1).

AA Sequence

MEAVVNLYQEVMKHADPRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLV      1 - 70
ALSLYIVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMVRVAWLFLFSKFIELMDTVIFILRKKDGQVTFL     71 - 140
HVFHHSVLPWSWWWGVKIAPGGMGSFHAMINSSVHVIMYLYYGLSAFGPVAQPYLWWKKHMTAIQLIQFV    141 - 210
LVSLHISQYYFMSSCNYQYPVIIHLIWMYGTIFFMLFSNFWYHSYTKGKRLPRALQQNGAPGIAKVKAN     211 - 279
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25499606 2015 Enzymatic characterization of ELOVL1, a key enzyme in very long-chain fatty acid synthesis.
24489110 2014 Lorenzo's oil inhibits ELOVL1 and lowers the level of sphingomyelin with a saturated very long-chain fatty acid.
23538298 2013 The equilibrium between long and very long chain ceramides is important for the fate of the cell and can be influenced by co-expression of CerS.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
20937905 2010 ELOVL1 production of C24 acyl-CoAs is linked to C24 sphingolipid synthesis.
20166112 2010 The role of ELOVL1 in very long-chain fatty acid homeostasis and X-linked adrenoleukodystrophy.
19946888 2010 Defining the membrane proteome of NK cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
More...