Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.00
PubTator Score 1.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 5.2e-06
non primary Sjogren syndrome sicca 891 2.1e-02

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 2.1e-02
osteosarcoma -1.429 5.2e-06

Gene RIF (1)

AA Sequence

MGPRVLQPPLLLLLLALLLAALPCGAEEASPLRPAQVTLSPPPAVTNGSQPGAPHNSTHTRPPGASGSAL      1 - 70
TRSFYVILGFCGLTALYFLIRAFRLKKPQRRRYGLLANTEDPTEMASLDSDEETVFESRNLR             71 - 132
//

Text Mined References (10)

PMID Year Title