Property Summary

NCBI Gene PubMed Count 6
PubMed Score 10.75
PubTator Score 5.00

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
ovarian cancer 8519 3.3e-03
Breast cancer 3577 3.2e-02
acute myeloid leukemia 783 4.7e-02


  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia -2.100 4.7e-02
Breast cancer 2.300 3.2e-02
ovarian cancer -1.100 3.3e-03

Gene RIF (2)

AA Sequence

QVKENPGSGEYDFRYIFVEIESYPRRTIIIEDNRSQDD                                    211 - 248

Text Mined References (8)

PMID Year Title