Property Summary

NCBI Gene PubMed Count 6
Grant Count 5
R01 Count 5
Funding $213,898.68
PubMed Score 10.63
PubTator Score 5.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 2.300 0.032
acute myeloid leukemia -2.100 0.047
ovarian cancer -1.600 0.000

Synonym

Accession Q9BVV7 Q9P010
Symbols TIM21
HSPC154
C18orf55

Gene

Gene RIF (2)

PMID Text
23260140 TIM21 is dispensable for protein import but required for integration of early-assembling, presequence-containing subunits into respiratory-chain intermediates.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MICTFLRAVQYTEKLHRSSAKRLLLPYIVLNKACLKTEPSLRCGLQYQKKTLRPRCILGVTQKTIWTQGP      1 - 70
SPRKAKEDGSKQVSVHRSQRGGTAVPTSQKVKEAGRDFTYLIVVLFGISITGGLFYTIFKELFSSSSPSK     71 - 140
IYGRALEKCRSHPEVIGVFGESVKGYGEVTRRGRRQHVRFTEYVKDGLKHTCVKFYIEGSEPGKQGTVYA    141 - 210
QVKENPGSGEYDFRYIFVEIESYPRRTIIIEDNRSQDD                                    211 - 248
//

Text Mined References (8)

PMID Year Title
26321642 2015 MITRAC7 Acts as a COX1-Specific Chaperone and Reveals a Checkpoint during Cytochrome c Oxidase Assembly.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23260140 2012 MITRAC links mitochondrial protein translocation to respiratory-chain assembly and translational regulation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.