Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.82
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 3.6e-08
psoriasis 6694 1.4e-03
lung cancer 4740 2.5e-03
group 3 medulloblastoma 4104 1.8e-02
Disease Target Count Z-score Confidence
Kidney disease 430 0.0 3.0
Disease Target Count Z-score Confidence
Chediak-Higashi syndrome 26 3.674 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.400 1.8e-02
lung cancer 1.300 2.5e-03
osteosarcoma -1.804 3.6e-08
psoriasis -1.100 1.4e-03

Gene RIF (2)

AA Sequence

MAPDSDPFPEGPLLKLLPLDARDRGTQRCRLGPAALHALGARLGSAVKISLPDGGSCLCTAWPRRDGADG      1 - 70
FVQLDPLCASPGAAVGASRSRRSLSLNRLLLVPCPPLRRVAVWPVLRERAGAPGARNTAAVLEAAQELLR     71 - 140
NRPISLGHVVVAPPGAPGLVAALHIVGGTPSPDPAGLVTPRTRVSLGGEPPSEAQPQPEVPLGGLSEAAD    141 - 210
SLRELLRLPLRYPRALTALGLAVPRGVLLAGPPGVGKTQLVRAVAREAGAELLAVSAPALQGSRPGETEE    211 - 280
NVRRVFQRARELASRGPSLLFLDEMDALCPQRGSRAPESRVVAQVLTLLDGASGDREVVVVGATNRPDAL    281 - 350
DPALRRPGRFDREVVIGTPTLKQRKEILQVITSKMPISSHVDLGLLAEMTVGYVGADLTALCREAAMHAL    351 - 420
LHSEKNQDNPVIDEIDFLEAFKNIQPSSFRSVIGLMDIKPVDWEEIGGLEDVKLKLKQSIEWPLKFPWEF    421 - 490
VRMGLTQPKGVLLYGPPGCAKTTLVRALATSCHCSFVSVSGADLFSPFVGDSEKVLSQIFRQARASTPAI    491 - 560
LFLDEIDSILGARSASKTGCDVQERVLSVLLNELDGVGLKTIERRGSKSSQQEFQEVFNRSVMIIAATNR    561 - 630
PDVLDTALLRPGRLDKIIYIPPPDHKGRLSILKVCTKTMPIGPDVSLENLAAETCFFSGADLRNLCTEAA    631 - 700
LLALQENGLDATTVKQEHFLKSLKTVKPSLSCKDLALYENLFKKEGFSNVEGI                     701 - 753
//

Text Mined References (10)

PMID Year Title