Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.44
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.100 0.001
osteosarcoma -1.804 0.000
lung cancer 1.300 0.003
group 3 medulloblastoma 1.400 0.018

Gene RIF (2)

PMID Text
25010285 Interaction of HIV-1 Gag with spermatogenesis associated 5-like 1 (SPATA5L1) is identified in a series of six affinity purification/mass spectrometry screens
19430482 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MAPDSDPFPEGPLLKLLPLDARDRGTQRCRLGPAALHALGARLGSAVKISLPDGGSCLCTAWPRRDGADG      1 - 70
FVQLDPLCASPGAAVGASRSRRSLSLNRLLLVPCPPLRRVAVWPVLRERAGAPGARNTAAVLEAAQELLR     71 - 140
NRPISLGHVVVAPPGAPGLVAALHIVGGTPSPDPAGLVTPRTRVSLGGEPPSEAQPQPEVPLGGLSEAAD    141 - 210
SLRELLRLPLRYPRALTALGLAVPRGVLLAGPPGVGKTQLVRAVAREAGAELLAVSAPALQGSRPGETEE    211 - 280
NVRRVFQRARELASRGPSLLFLDEMDALCPQRGSRAPESRVVAQVLTLLDGASGDREVVVVGATNRPDAL    281 - 350
DPALRRPGRFDREVVIGTPTLKQRKEILQVITSKMPISSHVDLGLLAEMTVGYVGADLTALCREAAMHAL    351 - 420
LHSEKNQDNPVIDEIDFLEAFKNIQPSSFRSVIGLMDIKPVDWEEIGGLEDVKLKLKQSIEWPLKFPWEF    421 - 490
VRMGLTQPKGVLLYGPPGCAKTTLVRALATSCHCSFVSVSGADLFSPFVGDSEKVLSQIFRQARASTPAI    491 - 560
LFLDEIDSILGARSASKTGCDVQERVLSVLLNELDGVGLKTIERRGSKSSQQEFQEVFNRSVMIIAATNR    561 - 630
PDVLDTALLRPGRLDKIIYIPPPDHKGRLSILKVCTKTMPIGPDVSLENLAAETCFFSGADLRNLCTEAA    631 - 700
LLALQENGLDATTVKQEHFLKSLKTVKPSLSCKDLALYENLFKKEGFSNVEGI                     701 - 753
//

Text Mined References (10)

PMID Year Title
23535967 2013 Using multiple measures for quantitative trait association analyses: application to estimated glomerular filtration rate.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
19430482 2009 Multiple loci associated with indices of renal function and chronic kidney disease.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.