Property Summary

NCBI Gene PubMed Count 9
Grant Count 3
Funding $1,101,564.6
PubMed Score 6.34
PubTator Score 15.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BVG9 PSS-2
Symbols PSS2

Gene

PANTHER Protein Class (1)

Gene RIF (1)

PMID Text
19014349 Purification and characterization of human phosphatidylserine synthases 1 and 2.

AA Sequence

MRRGERRDAGGPRPESPVPAGRASLEEPPDGPSAGQATGPGEGRRSTESEVYDDGTNTFFWRAHTLTVLF      1 - 70
ILTCTLGYVTLLEETPQDTAYNTKRGIVASILVFLCFGVTQAKDGPFSRPHPAYWRFWLCVSVVYELFLI     71 - 140
FILFQTVQDGRQFLKYVDPKLGVPLPERDYGGNCLIYDPDNETDPFHNIWDKLDGFVPAHFLGWYLKTLM    141 - 210
IRDWWMCMIISVMFEFLEYSLEHQLPNFSECWWDHWIMDVLVCNGLGIYCGMKTLEWLSLKTYKWQGLWN    211 - 280
IPTYKGKMKRIAFQFTPYSWVRFEWKPASSLRRWLAVCGIILVFLLAELNTFYLKFVLWMPPEHYLVLLR    281 - 350
LVFFVNVGGVAMREIYDFMDDPKPHKKLGPQAWLVAAITATELLIVVKYDPHTLTLSLPFYISQCWTLGS    351 - 420
VLALTWTVWRFFLRDITLRYKETRWQKWQNKDDQGSTVGNGDQHPLGLDEDLLGPGVAEGEGAPTPN       421 - 487
//

Text Mined References (20)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23724137 2013 Phospholipid biosynthesis genes and susceptibility to obesity: analysis of expression and polymorphisms.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23071296 2013 Phosphatidylserine synthase 2: high efficiency for synthesizing phosphatidylserine containing docosahexaenoic acid.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19014349 2009 Purification and characterization of human phosphatidylserine synthases 1 and 2.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
More...