Property Summary

NCBI Gene PubMed Count 7
PubMed Score 255.69
PubTator Score 4.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 3.2e-04
ependymoma 1.300 4.2e-03
glioblastoma 1.200 1.0e-02
group 4 medulloblastoma 1.700 2.3e-04
intraductal papillary-mucinous neoplasm ... 1.200 1.7e-02
lung cancer 1.200 4.7e-03
medulloblastoma, large-cell 1.900 6.1e-06
oligodendroglioma 1.400 4.0e-03
osteosarcoma -1.569 8.3e-04
ovarian cancer -1.400 1.4e-05
psoriasis 1.700 2.2e-04

Synonym

Accession Q9BVC5 B3KXN3 B4E2G9
Symbols asw

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MAGDVGGRSCTDSELLLHPELLSQEFLLLTLEQKNIAVETDVRVNKDSLTDLYVQHAIPLPQRDLPKNRW      1 - 70
GKMMEKKREQHEIKNETKRSSTVDGLRKRPLIVFDGSSTSTSIKVKKTENGDNDRLKPPPQASFTSNAFR     71 - 140
KLSNSSSSVSPLILSSNLPVNNKTEHNNNDAKQNHDLTHRKSPSGPVKSPPLSPVGTTPVKLKRAAPKEE    141 - 210
AEAMNNLKPPQAKRKIQHVTWP                                                    211 - 232
//

Text Mined References (15)

PMID Year Title