Property Summary

NCBI Gene PubMed Count 7
Grant Count 2
Funding $140,874.66
PubMed Score 216.68
PubTator Score 4.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
ependymoma 1.300 0.004
oligodendroglioma 1.400 0.004
psoriasis 1.700 0.000
osteosarcoma 1.804 0.002
atypical teratoid / rhabdoid tumor 1.300 0.000
glioblastoma 1.200 0.010
group 4 medulloblastoma 1.700 0.000
medulloblastoma, large-cell 1.900 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.017
lung cancer 1.200 0.005
ovarian cancer -1.400 0.000

Synonym

Accession Q9BVC5 B3KXN3 B4E2G9
Symbols asw

Gene

 Grant Application (2)

Gene RIF (2)

PMID Text
22944692 HIV-1 Rev interacting protein, chromosome 2 open reading frame 49, is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
22174317 HIV-1 Rev interacting protein, chromosome 2 open reading frame 49, is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells

AA Sequence

MAGDVGGRSCTDSELLLHPELLSQEFLLLTLEQKNIAVETDVRVNKDSLTDLYVQHAIPLPQRDLPKNRW      1 - 70
GKMMEKKREQHEIKNETKRSSTVDGLRKRPLIVFDGSSTSTSIKVKKTENGDNDRLKPPPQASFTSNAFR     71 - 140
KLSNSSSSVSPLILSSNLPVNNKTEHNNNDAKQNHDLTHRKSPSGPVKSPPLSPVGTTPVKLKRAAPKEE    141 - 210
AEAMNNLKPPQAKRKIQHVTWP                                                    211 - 232
//

Text Mined References (15)

PMID Year Title
24870230 2014 Analysis of orthologous groups reveals archease and DDX1 as tRNA splicing factors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21311021 2011 HSPC117 is the essential subunit of a human tRNA splicing ligase complex.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
More...