Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.30
PubTator Score 0.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 2.63202628270483E-7
pediatric high grade glioma 2712 6.74876059208535E-6
glioblastoma 5572 6.83927183098104E-6
medulloblastoma, large-cell 6234 7.45106244511361E-4
astrocytoma 1493 8.90103779850418E-4
primitive neuroectodermal tumor 3031 0.00107434066150036
osteosarcoma 7933 0.00116373890808022
diabetes mellitus 1663 0.00179789358774142
primary pancreatic ductal adenocarcinoma 1271 0.0076407106376768

Expression

  Differential Expression (9)

Synonym

Accession Q9BV87 B2RC77 O75548 Q9H4N0 Q9UQN0
Symbols CGI-57
C2orf24

Gene

  Ortholog (11)

AA Sequence

MDLTGLLLDEEGTFSLAGFQDFTFLPGHQKLSARIRRRLYYGWDWEADCSLEELSSPVADIAVELLQKAA      1 - 70
PSPIRRLQKKYVAHVSREACISPCAMMLALVYIERLRHRNPDYLQHVSSSDLFLISMMVASKYLYDEGEE     71 - 140
EEVFNDEWGAAGGVAVPTLNALERGFLSAMDWHLYTDPREIFEVLSWLESCVAEQQGRWRGWYTYTDLCV    141 - 210
LLEQPTWQLALGSLCQRLVKLSCLLAVAYVSSVALAVASVAVIHQSLGLSCIPTPGPPDLGLTSRCLLEP    211 - 280
CIPSVPQCLPSLANVSSCLEGSMGLRSLWGSLLASLTPPPLPPPDPPAPPTLLHNCHLCQKLQRDSPTCH    281 - 350
ACLHPNRTVPTALSSPWYHTYGLAPPWPWSPVLLSLPQPQQCSLFSVMELARLKSFVFPG              351 - 410
//

Text Mined References (8)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.