Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.30
PubTator Score 0.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.600 8.9e-04
atypical teratoid / rhabdoid tumor 1.600 2.6e-07
diabetes mellitus 1.900 2.0e-03
glioblastoma 1.800 6.8e-06
medulloblastoma, large-cell 1.200 7.5e-04
osteosarcoma -1.658 1.2e-03
pediatric high grade glioma 1.400 6.7e-06
primary pancreatic ductal adenocarcinoma 1.013 7.6e-03
primitive neuroectodermal tumor 1.100 1.1e-03

AA Sequence

MDLTGLLLDEEGTFSLAGFQDFTFLPGHQKLSARIRRRLYYGWDWEADCSLEELSSPVADIAVELLQKAA      1 - 70
PSPIRRLQKKYVAHVSREACISPCAMMLALVYIERLRHRNPDYLQHVSSSDLFLISMMVASKYLYDEGEE     71 - 140
EEVFNDEWGAAGGVAVPTLNALERGFLSAMDWHLYTDPREIFEVLSWLESCVAEQQGRWRGWYTYTDLCV    141 - 210
LLEQPTWQLALGSLCQRLVKLSCLLAVAYVSSVALAVASVAVIHQSLGLSCIPTPGPPDLGLTSRCLLEP    211 - 280
CIPSVPQCLPSLANVSSCLEGSMGLRSLWGSLLASLTPPPLPPPDPPAPPTLLHNCHLCQKLQRDSPTCH    281 - 350
ACLHPNRTVPTALSSPWYHTYGLAPPWPWSPVLLSLPQPQQCSLFSVMELARLKSFVFPG              351 - 410
//

Text Mined References (8)

PMID Year Title