Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.05
PubTator Score 2.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 0.001

Synonym

Accession Q9BV81
Symbols TMEM93

Gene

Gene RIF (1)

PMID Text
23182941 Endoplasmic membrane protein complex subunit 6 (EMC6) interacted with both RAB5A and BECN1/Beclin 1 and colocalized with the omegasome marker ZFYVE1/DFCP1.

AA Sequence

MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASVLLSLLLILKA      1 - 70
GRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY                                   71 - 110
//

Text Mined References (7)

PMID Year Title
23182941 2013 A novel ER-localized transmembrane protein, EMC6, interacts with RAB5A and regulates cell autophagy.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22119785 2011 Defining human ERAD networks through an integrative mapping strategy.
21269460 2011 Initial characterization of the human central proteome.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.