Property Summary

NCBI Gene PubMed Count 14
PubMed Score 12.96
PubTator Score 7.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (2)

AA Sequence

MAGKGSSGRRPLLLGLLVAVATVHLVICPYTKVEESFNLQATHDLLYHWQDLEQYDHLEFPGVVPRTFLG      1 - 70
PVVIAVFSSPAVYVLSLLEMSKFYSQLIVRGVLGLGVIFGLWTLQKEVRRHFGAMVATMFCWVTAMQFHL     71 - 140
MFYCTRTLPNVLALPVVLLALAAWLRHEWARFIWLSAFAIIVFRVELCLFLGLLLLLALGNRKVSVVRAL    141 - 210
RHAVPAGILCLGLTVAVDSYFWRQLTWPEGKVLWYNTVLNKSSNWGTSPLLWYFYSALPRGLGCSLLFIP    211 - 280
LGLVDRRTHAPTVLALGFMALYSLLPHKELRFIIYAFPMLNITAARGCSYLLNNYKKSWLYKAGSLLVIG    281 - 350
HLVVNAAYSATALYVSHFNYPGGVAMQRLHQLVPPQTDVLLHIDVAAAQTGVSRFLQVNSAWRYDKREDV    351 - 420
QPGTGMLAYTHILMEAAPGLLALYRDTHRVLASVVGTTGVSLNLTQLPPFNVHLQTKLVLLERLPRPS      421 - 488
//

Text Mined References (14)

PMID Year Title