Property Summary

NCBI Gene PubMed Count 13
PubMed Score 18.90
PubTator Score 13.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
cystic fibrosis 1.100 5.1e-04
group 3 medulloblastoma -1.200 1.6e-03
malignant mesothelioma 1.400 2.0e-05
osteosarcoma 1.211 5.8e-04
Polycystic ovary syndrome -1.010 2.6e-02
psoriasis 1.900 5.5e-08

Gene RIF (4)

AA Sequence

MGGAQLELPSGARPGVCVRRSFRAHAGDQPRRPPGPIPVPGTMKQESAAPNTPPTSQSPTPSAQFPRNDG      1 - 70
DPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQ     71 - 140
VQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKALAYVATPQNPGYLGPAPEEAIATQILAC    141 - 210
RGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLPCFCPTEQALALV                    211 - 264
//

Text Mined References (15)

PMID Year Title