Property Summary

NCBI Gene PubMed Count 13
Grant Count 8
Funding $205,450.34
PubMed Score 15.75
PubTator Score 13.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
psoriasis 4.700 0.000
osteosarcoma 1.211 0.001
cystic fibrosis 1.100 0.001
group 3 medulloblastoma -1.200 0.002
Polycystic Ovary Syndrome -1.010 0.026

Gene RIF (4)

PMID Text
25931127 Human CHAC1 Protein Degrades Glutathione, and mRNA Induction Is Regulated by the Transcription Factors ATF4 and ATF3 and a Bipartite ATF/CRE Regulatory Element.
24767995 Botch regulates Notch signaling through deglycination and identify a posttranslational modification of Notch that plays an important role in neurogenesis.
23342279 nisin exerts these effects on HNSCC, in part, through CHAC1, a proapoptotic cation transport regulator, and through a concomitant CHAC1-independent influx of extracellular calcium
22108517 High CHAC1 mRNA expression could be an independent indicator for elevated risk of cancer recurrence in breast and ovarian cancer

AA Sequence

MGGAQLELPSGARPGVCVRRSFRAHAGDQPRRPPGPIPVPGTMKQESAAPNTPPTSQSPTPSAQFPRNDG      1 - 70
DPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQ     71 - 140
VQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKALAYVATPQNPGYLGPAPEEAIATQILAC    141 - 210
RGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLPCFCPTEQALALV                    211 - 264
//

Text Mined References (14)

PMID Year Title
25931127 2015 Human CHAC1 Protein Degrades Glutathione, and mRNA Induction Is Regulated by the Transcription Factors ATF4 and ATF3 and a Bipartite ATF/CRE Regulatory Element.
24767995 2014 Botch is a ?-glutamyl cyclotransferase that deglycinates and antagonizes Notch.
23342279 2012 Nisin, an apoptogenic bacteriocin and food preservative, attenuates HNSCC tumorigenesis via CHAC1.
23070364 2012 Mammalian proapoptotic factor ChaC1 and its homologues function as ?-glutamyl cyclotransferases acting specifically on glutathione.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22445366 2012 Botch promotes neurogenesis by antagonizing Notch.
22108517 2012 Elevated mRNA expression of CHAC1 splicing variants is associated with poor outcome for breast and ovarian cancer patients.
19109178 2009 CHAC1/MGC4504 is a novel proapoptotic component of the unfolded protein response, downstream of the ATF4-ATF3-CHOP cascade.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16341674 2005 Transcriptome analysis of human gastric cancer.
More...