Property Summary

NCBI Gene PubMed Count 14
PubMed Score 92.23
PubTator Score 17.40

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

AA Sequence

MASEELACKLERRLRREEAEESGPQLAPLGAPAPEPKPEPEPPARAPTASADAELSAQLSRRLDINEGAA      1 - 70
RPRRCRVFNPYTEFPEFSRRLIKDLESMFKLYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDE     71 - 140
DFDGKLSFREFLLIFHKAAAGELQEDSGLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELK    141 - 210
AEQDERKREEEERRLRQAAFQKLKANFNT                                             211 - 239
//

Text Mined References (16)

PMID Year Title