Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.24
PubTator Score 3.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
acute myeloid leukemia 783 3.158 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 2.5e-05
ependymoma 1.200 1.1e-07
group 3 medulloblastoma 1.200 1.2e-02
ovarian cancer 1.300 1.1e-04
Rheumatoid arthritis -1.300 4.9e-02

Gene RIF (1)

AA Sequence

MLEAMAEPSPEDPPPTLKPETQPPEKRRRTIEDFNKFCSFVLAYAGYIPPSKEESDWPASGSSSPLRGES      1 - 70
AADSDGWDSAPSDLRTIQTFVKKAKSSKRRAAQAGPTQPGPPRSTFSRLQAPDSATLLEKMKLKDSLFDL     71 - 140
DGPKVASPLSPTSLTHTSRPPAALTPVPLSQGDLSHPPRKKDRKNRKLGPGAGAGFGVLRRPRPTPGDGE    141 - 210
KRSRIKKSKKRKLKKAERGDRLPPPGPPQAPPSDTDSEEEEEEEEEEEEEEMATVVGGEAPVPVLPTPPE    211 - 280
APRPPATVHPEGVPPADSESKEVGSTETSQDGDASSSEGEMRVMDEDIMVESGDDSWDLITCYCRKPFAG    281 - 350
RPMIECSLCGTWIHLSCAKIKKTNVPDFFYCQKCKELRPEARRLGGPPKSGEP                     351 - 403
//

Text Mined References (15)

PMID Year Title