Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.52
PubTator Score 0.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
tuberculosis 1.100 0.000
adult high grade glioma -1.500 0.000
sonic hedgehog group medulloblastoma -1.200 0.001
subependymal giant cell astrocytoma -1.371 0.022
pituitary cancer 1.500 0.000

Synonym

Accession Q9BUJ0 Q6UXU8 Q9Y3T7
Symbols DORZ1

Gene

PANTHER Protein Class (3)

Gene RIF (1)

PMID Text
14667578 Identification and characterization of Mouse Dorz1, along with sequence comparison to a similar protein in human.

AA Sequence

MVGALCGCWFRLGGARPLIPLGPTVVQTSMSRSQVALLGLSLLLMLLLYVGLPGPPEQTSCLWGDPNVTV      1 - 70
LAGLTPGNSPIFYREVLPLNQAHRVEVVLLHGKAFNSHTWEQLGTLQLLSQRGYRAVALDLPGFGNSAPS     71 - 140
KEASTEAGRAALLERALRDLEVQNAVLVSPSLSGHYALPFLMRGHHQLHGFVPIAPTSTQNYTQEQFWAV    141 - 210
KTPTLILYGELDHILARESLRQLRHLPNHSVVKLRNAGHACYLHKPQDFHLVLLAFLDHLP             211 - 271
//

Text Mined References (8)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14667578 2003 Dorz1, a novel gene expressed in differentiating cerebellar granule neurons, is down-regulated in Zic1-deficient mouse.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.