Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.87
PubTator Score 5.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Gene RIF (3)

PMID Text
21358628 The study reports the crystal structure of RPC62.
20970119 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
1403646 HIV-1 Tat upregulates the transcription by RNA polymerase III of co-transfected or endogenous cellular Alu-repeated sequences by activating transcription factor TFIIIC

AA Sequence

MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTGTSLDQVKKALCVLVQHNLVSYQVHKR      1 - 70
GVVEYEAQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSAVVKKVADRLTETMEDGKTMD     71 - 140
YAEVSNTFVRLADTHFVQRCPSVPTTENSDPGPPPPAPTLVINEKDMYLVPKLSLIGKGKRRRSSDEDAA    141 - 210
GEPKAKRPKYTTDNKEPIPDDGIYWQANLDRFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSS    211 - 280
SAPFTQPLSSNEIFRSLPVGYNISKQVLDQYLTLLADDPLEFVGKSGDSGGGMYVINLHKALASLATATL    281 - 350
ESVVQERFGSRCARIFRLVLQKKHIEQKQVEDFAMIPAKEAKDMLYKMLSENFMSLQEIPKTPDHAPSRT    351 - 420
FYLYTVNILSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIIASMQATGAEEAQLQEIEEM    421 - 490
ITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIECTMKRQ                              491 - 534
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24107381 2014 Gene duplication and neofunctionalization: POLR3G and POLR3GL.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21358628 2011 Structure-function analysis of hRPC62 provides insights into RNA polymerase III transcription initiation.
21269460 2011 Initial characterization of the human central proteome.
20970119 2011 Convergent animal and human evidence suggests a role of PPM1A gene in response to antidepressants.
19631370 2009 RNA polymerase III detects cytosolic DNA and induces type I interferons through the RIG-I pathway.
19609254 2009 RIG-I-dependent sensing of poly(dA:dT) through the induction of an RNA polymerase III-transcribed RNA intermediate.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...