Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.87
PubTator Score 5.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Protein-protein Interaction (8)

Gene RIF (3)

PMID Text
21358628 The study reports the crystal structure of RPC62.
20970119 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
1403646 HIV-1 Tat upregulates the transcription by RNA polymerase III of co-transfected or endogenous cellular Alu-repeated sequences by activating transcription factor TFIIIC

AA Sequence

MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTGTSLDQVKKALCVLVQHNLVSYQVHKR      1 - 70
GVVEYEAQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSAVVKKVADRLTETMEDGKTMD     71 - 140
YAEVSNTFVRLADTHFVQRCPSVPTTENSDPGPPPPAPTLVINEKDMYLVPKLSLIGKGKRRRSSDEDAA    141 - 210
GEPKAKRPKYTTDNKEPIPDDGIYWQANLDRFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSS    211 - 280
SAPFTQPLSSNEIFRSLPVGYNISKQVLDQYLTLLADDPLEFVGKSGDSGGGMYVINLHKALASLATATL    281 - 350
ESVVQERFGSRCARIFRLVLQKKHIEQKQVEDFAMIPAKEAKDMLYKMLSENFMSLQEIPKTPDHAPSRT    351 - 420
FYLYTVNILSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIIASMQATGAEEAQLQEIEEM    421 - 490
ITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIECTMKRQ                              491 - 534
//

Publication (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24107381 2014 Gene duplication and neofunctionalization: POLR3G and POLR3GL.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21358628 2011 Structure-function analysis of hRPC62 provides insights into RNA polymerase III transcription initiation.
21269460 2011 Initial characterization of the human central proteome.
20970119 2011 Convergent animal and human evidence suggests a role of PPM1A gene in response to antidepressants.
19631370 2009 RNA polymerase III detects cytosolic DNA and induces type I interferons through the RIG-I pathway.
19609254 2009 RIG-I-dependent sensing of poly(dA:dT) through the induction of an RNA polymerase III-transcribed RNA intermediate.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...