Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.37
PubTator Score 5.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Herpes zoster 68 0.0 5.0
Disease Target Count Z-score Confidence
Chickenpox 8 3.39 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.400 3.4e-04
intraductal papillary-mucinous neoplasm ... -1.200 1.4e-03
medulloblastoma, large-cell 1.200 3.7e-05
ovarian cancer 1.200 1.0e-04

Protein-protein Interaction (1)

Gene RIF (4)

AA Sequence

MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTGTSLDQVKKALCVLVQHNLVSYQVHKR      1 - 70
GVVEYEAQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSAVVKKVADRLTETMEDGKTMD     71 - 140
YAEVSNTFVRLADTHFVQRCPSVPTTENSDPGPPPPAPTLVINEKDMYLVPKLSLIGKGKRRRSSDEDAA    141 - 210
GEPKAKRPKYTTDNKEPIPDDGIYWQANLDRFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSS    211 - 280
SAPFTQPLSSNEIFRSLPVGYNISKQVLDQYLTLLADDPLEFVGKSGDSGGGMYVINLHKALASLATATL    281 - 350
ESVVQERFGSRCARIFRLVLQKKHIEQKQVEDFAMIPAKEAKDMLYKMLSENFMSLQEIPKTPDHAPSRT    351 - 420
FYLYTVNILSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIIASMQATGAEEAQLQEIEEM    421 - 490
ITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIECTMKRQ                              491 - 534
//

Text Mined References (22)

PMID Year Title