Property Summary

NCBI Gene PubMed Count 11
PubMed Score 18.54
PubTator Score 2.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
astrocytoma 1493 9.76900306916796E-24
oligodendroglioma 2849 1.24653027831005E-19
atypical teratoid/rhabdoid tumor 1095 1.13695498869304E-10
glioblastoma 5572 1.26561765599187E-9
non-inflammatory breast cancer 208 1.99569176788313E-7
medulloblastoma 1524 4.46408337738869E-7
ependymoma 2514 1.22769391104267E-6
medulloblastoma, large-cell 6234 2.56894355393272E-6
adult high grade glioma 2148 7.08234373918431E-6
pilocytic astrocytoma 3086 7.21673469666895E-6
osteosarcoma 7933 7.12652855636027E-4
pituitary cancer 1972 0.00611536658159561
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0101943631243734
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0192244754281068

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma -1.600 0.000
oligodendroglioma -1.500 0.000
glioblastoma -2.000 0.000
osteosarcoma -1.521 0.001
ependymoma -1.300 0.000
medulloblastoma -2.300 0.000
atypical teratoid/rhabdoid tumor -2.600 0.000
medulloblastoma, large-cell -2.100 0.000
intraductal papillary-mucinous adenoma (... -1.100 0.010
intraductal papillary-mucinous neoplasm ... -1.500 0.019
adult high grade glioma -2.300 0.000
pilocytic astrocytoma -1.500 0.000
non-inflammatory breast cancer -1.800 0.000
pituitary cancer -1.300 0.006

Synonym

Accession Q9BUH8 Q9NPU3 Q9P282
Symbols

Gene

  Ortholog (11)

Species Source
Macaque OMA EggNOG
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
24662927 This study found in BEGAIN was most significant and also showed significant correlations with gene expression.

AA Sequence

MEKLSALQEQKGELRKRLSYTTHKLEKLETEFDSTRHYLEIELRRAQEELEKVTEKLRRIQSNYMALQRI      1 - 70
NQELEDKLYRMGQHYEEEKRALSHEIVALNSHLLEAKVTIDKLSEDNELYRKDCNLAAQLLQCSQTYGRV     71 - 140
HKVSELPSDFQERVSLHMEKHGCSLPSPLCHPAYADSVPTCVIAKVLEKPDPASLSSRLSDASARDLAFC    141 - 210
DGVEKPGPRPPYKGDIYCSDTALYCPEERRRDRRPSVDAPVTDVGFLRAQNSTDSAAEEEEEAEAAAFPA    211 - 280
GFQHEAFPSYAGSLPTSSSYSSFSATSEEKEHAQASTLTASQQAIYLNSRDELFDRKPPATTYEGSPRFA    281 - 350
KATAAVAAPLEAEVAPGFGRTMSPYPAETFRFPASPGPQQALMPPNLWSLRAKPGTARLPGEDMRGQWRP    351 - 420
LSVEDIGAYSYPVSAAGRASPCSFSERYYGGAGGSPGKKADGRASPLYASYKADSFSEGDDLSQGHLAEP    421 - 490
CFLRAGGDLSLSPGRSADPLPGYAPSEGGDGDRLGVQLCGTASSPEPEQGSRDSLEPSSMEASPEMHPAA    491 - 560
RLSPQQAFPRTGGSGLSRKDSLTKAQLYGTLLN                                         561 - 593
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24662927 2015 Astrocytic abnormalities and global DNA methylation patterns in depression and suicide.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...