Property Summary

NCBI Gene PubMed Count 12
PubMed Score 19.59
PubTator Score 2.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.300 7.1e-06
astrocytic glioma -1.200 1.3e-02
Astrocytoma, Pilocytic -1.500 8.3e-06
atypical teratoid / rhabdoid tumor -2.500 5.1e-08
ependymoma -1.300 1.2e-06
glioblastoma -2.000 1.3e-09
group 4 medulloblastoma -2.000 5.6e-05
inflammatory breast cancer -1.600 1.4e-05
intraductal papillary-mucinous adenoma (... -1.100 1.0e-02
intraductal papillary-mucinous neoplasm ... -1.500 1.9e-02
medulloblastoma, large-cell -2.100 2.6e-06
oligodendroglioma -1.300 1.4e-02
osteosarcoma -1.521 7.1e-04
pituitary cancer -1.300 6.1e-03

Gene RIF (2)

AA Sequence

MEKLSALQEQKGELRKRLSYTTHKLEKLETEFDSTRHYLEIELRRAQEELEKVTEKLRRIQSNYMALQRI      1 - 70
NQELEDKLYRMGQHYEEEKRALSHEIVALNSHLLEAKVTIDKLSEDNELYRKDCNLAAQLLQCSQTYGRV     71 - 140
HKVSELPSDFQERVSLHMEKHGCSLPSPLCHPAYADSVPTCVIAKVLEKPDPASLSSRLSDASARDLAFC    141 - 210
DGVEKPGPRPPYKGDIYCSDTALYCPEERRRDRRPSVDAPVTDVGFLRAQNSTDSAAEEEEEAEAAAFPA    211 - 280
GFQHEAFPSYAGSLPTSSSYSSFSATSEEKEHAQASTLTASQQAIYLNSRDELFDRKPPATTYEGSPRFA    281 - 350
KATAAVAAPLEAEVAPGFGRTMSPYPAETFRFPASPGPQQALMPPNLWSLRAKPGTARLPGEDMRGQWRP    351 - 420
LSVEDIGAYSYPVSAAGRASPCSFSERYYGGAGGSPGKKADGRASPLYASYKADSFSEGDDLSQGHLAEP    421 - 490
CFLRAGGDLSLSPGRSADPLPGYAPSEGGDGDRLGVQLCGTASSPEPEQGSRDSLEPSSMEASPEMHPAA    491 - 560
RLSPQQAFPRTGGSGLSRKDSLTKAQLYGTLLN                                         561 - 593
//

Text Mined References (19)

PMID Year Title