Property Summary

NCBI Gene PubMed Count 11
Grant Count 29
R01 Count 3
Funding $13,902,315.5
PubMed Score 18.54
PubTator Score 2.43

Knowledge Summary


No data available


  Differential Expression (14)

Disease log2 FC p
astrocytoma -1.600 0.000
oligodendroglioma -1.500 0.000
glioblastoma -2.000 0.000
osteosarcoma -1.521 0.001
ependymoma -1.300 0.000
medulloblastoma -2.300 0.000
atypical teratoid/rhabdoid tumor -2.600 0.000
medulloblastoma, large-cell -2.100 0.000
intraductal papillary-mucinous adenoma (... -1.100 0.010
intraductal papillary-mucinous neoplasm ... -1.500 0.019
adult high grade glioma -2.300 0.000
pilocytic astrocytoma -1.500 0.000
non-inflammatory breast cancer -1.800 0.000
pituitary cancer -1.300 0.006

Gene RIF (1)

24662927 This study found in BEGAIN was most significant and also showed significant correlations with gene expression.

AA Sequence

RLSPQQAFPRTGGSGLSRKDSLTKAQLYGTLLN                                         561 - 593

Publication (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24662927 2015 Astrocytic abnormalities and global DNA methylation patterns in depression and suicide.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.