Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.14
PubTator Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 4.73928409697079E-45
non-small cell lung cancer 2798 4.88677149570349E-5
ulcerative colitis 2087 0.0013350523490691
ovarian cancer 8492 0.00180269355983842
invasive ductal carcinoma 2950 0.00227476674911001
osteosarcoma 7933 0.00401291419389285
interstitial cystitis 2299 0.00491923220830312
ductal carcinoma in situ 1745 0.00602684646703362
esophageal adenocarcinoma 737 0.0190553920760902
breast carcinoma 1614 0.0347308365605126
spina bifida 1064 0.0375190743557201
fibroadenoma 557 0.0408206514779007
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0423035277420241

Expression

  Differential Expression (13)

Disease log2 FC p
esophageal adenocarcinoma 2.000 0.019
psoriasis -1.700 0.000
osteosarcoma 1.069 0.004
pancreatic ductal adenocarcinoma liver m... 1.486 0.042
non-small cell lung cancer -1.233 0.000
breast carcinoma 1.300 0.035
fibroadenoma 2.300 0.041
interstitial cystitis -1.400 0.005
spina bifida -1.408 0.038
ductal carcinoma in situ 2.600 0.006
invasive ductal carcinoma 2.900 0.002
ulcerative colitis -1.200 0.001
ovarian cancer -1.300 0.002

Synonym

Accession Q9BU68 D3DTU0
Symbols ATAD4

Gene

  Ortholog (12)

 Compartment GO Term (1)

AA Sequence

MTTEIGWWKLTFLRKKKSTPKVLYEIPDTYAQTEGDAEPPRPDAGGPNSDFNTRLEKIVDKSTKGKHVKV      1 - 70
SNSGRFKEKKKVRATLAENPNLFDDHEEGRSSK                                          71 - 103
//

Text Mined References (5)

PMID Year Title
22949513 2012 Genome-wide association analysis of genetic generalized epilepsies implicates susceptibility loci at 1q43, 2p16.1, 2q22.3 and 17q21.32.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.