Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.14
PubTator Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
esophageal adenocarcinoma 2.000 0.019
psoriasis -1.700 0.000
osteosarcoma 1.069 0.004
pancreatic ductal adenocarcinoma liver m... 1.486 0.042
non-small cell lung cancer -1.233 0.000
breast carcinoma 1.300 0.035
fibroadenoma 2.300 0.041
interstitial cystitis -1.400 0.005
spina bifida -1.408 0.038
ductal carcinoma in situ 2.600 0.006
invasive ductal carcinoma 2.900 0.002
ulcerative colitis -1.200 0.001
ovarian cancer -1.300 0.002

Synonym

Accession Q9BU68 D3DTU0
Symbols ATAD4

Gene

 Compartment GO Term (0)

AA Sequence

MTTEIGWWKLTFLRKKKSTPKVLYEIPDTYAQTEGDAEPPRPDAGGPNSDFNTRLEKIVDKSTKGKHVKV      1 - 70
SNSGRFKEKKKVRATLAENPNLFDDHEEGRSSK                                          71 - 103
//

Publication (5)

PMID Year Title
22949513 2012 Genome-wide association analysis of genetic generalized epilepsies implicates susceptibility loci at 1q43, 2p16.1, 2q22.3 and 17q21.32.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.