Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.90
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BU23 A6NEZ0 Q13392 Q6ZNR2 Q8WU74 Q96C62
Symbols TMEM153
TMEM112B

Gene

Gene RIF (1)

PMID Text
26742120 DNA methylation in the NCAPH2/LMF2 promoter region is significantly decreased in Alzheimer disease.

AA Sequence

MAGSRLPRQLFLQGVAAVFMFAFASLYTQIPGLYGPEGILPARRTLRPQGKGRWQQLWETPTLLWEAPRL      1 - 70
GLDTAQGLELLSLLGALVALGALLLSPLRHPVIYLLLWAAYLSACQVGQVFLYFQWDSLLLETGFLAVLV     71 - 140
APLRPASHRKEAPQGRQAGALPHEDLPFWLVRWLLFRLMFASGVVKLTSRCPAWWGLTALTYHYETQCLP    141 - 210
TPAAWFAHHLPVWLHKLSVVATFLIEIAVPPLFFAPIRRLRLAAFYSQVLLQVLIIITGNYNFFNLMTLV    211 - 280
LTTALLDDQHLAAEPGHGSRKKTATSWPKALLATLSLLLELAVYGLLAYGTVHYFGLEVDWQQRTIHSRT    281 - 350
TFTFHQFSQWLKTLTLPTVWLGVASLVWELLSALWRWTQVRGWLRKLSAVVQLSLVGTATVALFLISLVP    351 - 420
YSYVEPGTHGRLWTGAHRLFGAVEHLQLANSYGLFRRMTGLGGRPEVVLEGSYDGHHWTEIEFMYKPGNL    421 - 490
SRPPPVVVPHQPRLDWQMWFAALGPHTHSPWFTSLVLRLLQGKEPVIRLVQSQVARYPFHKQPPTYVRAQ    491 - 560
RYKYWFSQPGEQGQWWRRQWVEEFFPSVSLGDPTLETLLRQFGLQEKSPPRTRSANSTLAQALHWTRSQL    561 - 630
SPLEAPALLWGLLMAVGAVRFVQALLAPCSLRSSPLAPVSGEKRRPASQKDSGAASEQATAAPNPCSSSS    631 - 700
RTTRRKK                                                                   701 - 707
//

Text Mined References (11)

PMID Year Title
26742120 2016 Development of Biomarkers Based on DNA Methylation in the NCAPH2/LMF2 Promoter Region for Diagnosis of Alzheimer's Disease and Amnesic Mild Cognitive Impairment.
25416956 2014 A proteome-scale map of the human interactome network.
19946888 2010 Defining the membrane proteome of NK cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17994020 2007 Mutations in LMF1 cause combined lipase deficiency and severe hypertriglyceridemia.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...