Property Summary

NCBI Gene PubMed Count 7
PubMed Score 22.17
PubTator Score 9.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Batten disease 13 3.682 1.8

Expression

Protein-protein Interaction (2)

AA Sequence

MARPPVPGSVVVPNWHESAEGKEYLACILRKNRRRVFGLLERPVLLPPVSIDTASYKIFVSGKSGVGKTA      1 - 70
LVAKLAGLEVPVVHHETTGIQTTVVFWPAKLQASSRVVMFRFEFWDCGESALKKFDHMLLACMENTDAFL     71 - 140
FLFSFTDRASFEDLPGQLARIAGEAPGVVRMVIGSKFDQYMHTDVPERDLTAFRQAWELPLLRVKSVPGR    141 - 210
RLADGRTLDGRAGLADVAHILNGLAEQLWHQDQVAAGLLPNPPESAPE                          211 - 258
//

Text Mined References (10)

PMID Year Title