Property Summary

NCBI Gene PubMed Count 7
PubMed Score 21.17
PubTator Score 9.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Batten disease 15 3.746 1.9

Expression

Synonym

Accession Q9BU20 Q5TEV7
Symbols C1orf89

Gene

 GO Function (1)

AA Sequence

MARPPVPGSVVVPNWHESAEGKEYLACILRKNRRRVFGLLERPVLLPPVSIDTASYKIFVSGKSGVGKTA      1 - 70
LVAKLAGLEVPVVHHETTGIQTTVVFWPAKLQASSRVVMFRFEFWDCGESALKKFDHMLLACMENTDAFL     71 - 140
FLFSFTDRASFEDLPGQLARIAGEAPGVVRMVIGSKFDQYMHTDVPERDLTAFRQAWELPLLRVKSVPGR    141 - 210
RLADGRTLDGRAGLADVAHILNGLAEQLWHQDQVAAGLLPNPPESAPE                          211 - 258
//

Publication (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
19767740 2009 The planar cell polarity effector Fuz is essential for targeted membrane trafficking, ciliogenesis and mouse embryonic development.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.