Property Summary

NCBI Gene PubMed Count 26
PubMed Score 46.64
PubTator Score 25.07

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

AA Sequence

MHKAGLLGLCARAWNSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVD      1 - 70
QAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDI     71 - 140
NVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCL    141 - 210
APGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL      211 - 278
//

Text Mined References (31)

PMID Year Title