Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.57
PubTator Score 8.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma 1.300 8.0e-04
atypical teratoid / rhabdoid tumor 2.400 2.1e-08
Breast cancer 1.200 3.8e-07
breast carcinoma 1.100 2.1e-19
colon cancer 1.100 4.0e-02
ductal carcinoma in situ 1.100 8.2e-04
ependymoma 1.500 2.2e-09
glioblastoma 1.700 1.3e-07
group 3 medulloblastoma 1.500 4.5e-03
intraductal papillary-mucinous carcinoma... 1.100 3.7e-03
intraductal papillary-mucinous neoplasm ... 2.100 1.4e-03
invasive ductal carcinoma 1.500 2.6e-03
lung adenocarcinoma 1.019 1.6e-04
lung cancer 3.100 4.2e-05
medulloblastoma, large-cell 3.000 7.1e-06
non-small cell lung cancer 1.916 1.7e-23
ovarian cancer 1.100 1.3e-04
primitive neuroectodermal tumor 1.100 2.3e-03

Gene RIF (5)

AA Sequence

MATAVSRPCAGRSRDILWRVLGWRIVASIVWSVLFLPICTTVFIIFSRIDLFHPIQWLSDSFSDLYSSYV      1 - 70
IFYFLLLSVVIIIISIFNVEFYAVVPSIPCSRLALIGKIIHPQQLMHSFIHAAMGMVMAWCAAVITQGQY     71 - 140
SFLVVPCTGTNSFGSPAAQTCLNEYHLFFLLTGAFMGYSYSLLYFVNNMNYLPFPIIQQYKFLRFRRSLL    141 - 210
LLVKHSCVESLFLVRNFCILYYFLGYIPKAWISTAMNLHIDEQVHRPLDTVSGLLNLSLLYHVWLCGVFL    211 - 280
LTTWYVSWILFKIYATEAHVFPVQPPFAEGSDECLPKVLNSNPPPIIKYLALQDLMLLSQYSPSRRQEVF    281 - 350
SLSQPGGHPHNWTAISRECLNLLNGMTQKLILYQEAAATNGRVSSSYPVEPKKLNSPEETAFQTPKSSQM    351 - 420
PRPSVPPLVKTSLFSSKLSTPDVVSPFGTPFGSSVMNRMAGIFDVNTCYGSPQSPQLIRRGPRLWTSASD    421 - 490
QQMTEFSNPSPSTSISAEGKTMRQPSVIYSWIQNKREQIKNFLSKRVLIMYFFSKHPEASIQAVFSDAQM    491 - 560
HIWALEGLSHLVAASFTEDRFGVVQTTLPAILNTLLTLQEAVDKYFKLPHASSKPPRISGSLVDTSYKTL    561 - 630
RFAFRASLKTAIYRITTTFGEHLNAVQASAEHQKRLQQFLEFKE                              631 - 674
//

Text Mined References (21)

PMID Year Title