Property Summary

NCBI Gene PubMed Count 34
PubMed Score 17.17
PubTator Score 43.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.142 4.0e-06
atypical teratoid / rhabdoid tumor 1.200 1.7e-07
diabetes mellitus -1.100 1.8e-03
ependymoma 1.200 7.3e-14
glioblastoma 1.200 3.8e-02
head and neck cancer -1.200 8.1e-03
osteosarcoma 1.275 3.9e-03
ovarian cancer -1.800 8.0e-09
pancreatic cancer 1.100 2.4e-02
primary pancreatic ductal adenocarcinoma 1.158 6.3e-03

Gene RIF (18)

AA Sequence

MAANYSSTSTRREHVKVKTSSQPGFLERLSETSGGMFVGLMAFLLSFYLIFTNEGRALKTATSLAEGLSL      1 - 70
VVSPDSIHSVAPENEGRLVHIIGALRTSKLLSDPNYGVHLPAVKLRRHVEMYQWVETEESREYTEDGQVK     71 - 140
KETRYSYNTEWRSEIINSKNFDREIGHKNPSAMAVESFMATAPFVQIGRFFLSSGLIDKVDNFKSLSLSK    141 - 210
LEDPHVDIIRRGDFFYHSENPKYPEVGDLRVSFSYAGLSGDDPDLGPAHVVTVIARQRGDQLVPFSTKSG    211 - 280
DTLLLLHHGDFSAEEVFHRELRSNSMKTWGLRAAGWMAMFMGLNLMTRILYTLVDWFPVFRDLVNIGLKA    281 - 350
FAFCVATSLTLLTVAAGWLFYRPLWALLIAGLALVPILVARTRVPAKKLE                        351 - 400
//

Text Mined References (40)

PMID Year Title