Property Summary

NCBI Gene PubMed Count 8
PubMed Score 13.69
PubTator Score 5.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma 1.200 6.8e-03
Down syndrome 1.100 7.3e-04
ductal carcinoma in situ 1.500 2.6e-04
Endometriosis -1.018 2.0e-02
ependymoma 1.100 4.5e-02
interstitial cystitis -1.100 7.4e-04
intraductal papillary-mucinous adenoma (... 1.100 9.5e-03
intraductal papillary-mucinous carcinoma... 1.200 8.5e-03
intraductal papillary-mucinous neoplasm ... 2.100 1.2e-02
invasive ductal carcinoma 1.900 1.7e-03
osteosarcoma 1.403 1.7e-02
ovarian cancer -2.000 2.2e-05
Pick disease 1.100 1.4e-02
progressive supranuclear palsy -1.100 1.2e-02
psoriasis -1.300 3.7e-04
spina bifida -1.981 4.8e-02

Gene RIF (1)

AA Sequence

MFHCIPLWRCNRHVESIDKRHCSLVYVPEEIYRYARSLEELLLDANQLRELPEQFFQLVKLRKLGLSDNE      1 - 70
IQRLPPEIANFMQLVELDVSRNEIPEIPESISFCKALQVADFSGNPLTRLPESFPELQNLTCLSVNDISL     71 - 140
QSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLS    141 - 210
ELPQEIGNLKNLLCLDVSENRLERLPEEISGLTSLTDLVISQNLLETIPDGIGKLKKLSILKVDQNRLTQ    211 - 280
LPEAVGECESLTELVLTENQLLTLPKSIGKLKKLSNLNADRNKLVSLPKEIGGCCSLTVFCVRDNRLTRI    281 - 350
PAEVSQATELHVLDVAGNRLLHLPLSLTALKLKALWLSDNQSQPLLTFQTDTDYTTGEKILTCVLLPQLP    351 - 420
SEPTCQENLPRCGALENLVNDVSDEAWNERAVNRVSAIRFVEDEKDEEDNETRTLLRRATPHPGELKHMK    421 - 490
KTVENLRNDMNAAKGLDSNKNEVNHAIDRVTTSV                                        491 - 524
//

Text Mined References (10)

PMID Year Title