Property Summary

NCBI Gene PubMed Count 8
PubMed Score 13.11
PubTator Score 5.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 9.62199354618806E-9
ovarian cancer 8492 2.16461399598194E-5
ductal carcinoma in situ 1745 2.56922085528601E-4
psoriasis 6685 3.68434821885911E-4
Down syndrome 548 7.29334882920576E-4
interstitial cystitis 2299 7.3980140966033E-4
invasive ductal carcinoma 2950 0.00173734003553151
astrocytic glioma 2241 0.00684877985938751
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00852751176431268
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00945036763991988
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.011867224193784
progressive supranuclear palsy 674 0.0121362564321511
Endometriosis 535 0.0126728324649306
Pick disease 1893 0.0141554377553907
osteosarcoma 7933 0.0174818662459436
spina bifida 1064 0.0480915845743468
Disease Target Count Z-score Confidence
Juvenile myoclonic epilepsy 17 4.381 2.2

Expression

Synonym

Accession Q9BTT6 Q5TGN3 Q9HAC0 Q9NVF1
Symbols LANO
dJ523E19.1

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (1)

PMID Text
23645086 LRRC1 contributes to HCC development, and may be a potential target for therapeutic intervention in this disease.

AA Sequence

MFHCIPLWRCNRHVESIDKRHCSLVYVPEEIYRYARSLEELLLDANQLRELPEQFFQLVKLRKLGLSDNE      1 - 70
IQRLPPEIANFMQLVELDVSRNEIPEIPESISFCKALQVADFSGNPLTRLPESFPELQNLTCLSVNDISL     71 - 140
QSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLS    141 - 210
ELPQEIGNLKNLLCLDVSENRLERLPEEISGLTSLTDLVISQNLLETIPDGIGKLKKLSILKVDQNRLTQ    211 - 280
LPEAVGECESLTELVLTENQLLTLPKSIGKLKKLSNLNADRNKLVSLPKEIGGCCSLTVFCVRDNRLTRI    281 - 350
PAEVSQATELHVLDVAGNRLLHLPLSLTALKLKALWLSDNQSQPLLTFQTDTDYTTGEKILTCVLLPQLP    351 - 420
SEPTCQENLPRCGALENLVNDVSDEAWNERAVNRVSAIRFVEDEKDEEDNETRTLLRRATPHPGELKHMK    421 - 490
KTVENLRNDMNAAKGLDSNKNEVNHAIDRVTTSV                                        491 - 524
//

Text Mined References (10)

PMID Year Title
23645086 2013 Aberrant upregulation of LRRC1 contributes to human hepatocellular carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12200217 2002 Identification and mutational analysis of candidate genes for juvenile myoclonic epilepsy on 6p11-p12: LRRC1, GCLC, KIAA0057 and CLIC5.
11440998 2001 Lano, a novel LAP protein directly connected to MAGUK proteins in epithelial cells.