Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
interstitial cystitis 2312 7.3e-05
osteosarcoma 7950 3.2e-03

Expression

  Differential Expression (2)

Disease log2 FC p
interstitial cystitis 1.700 7.3e-05
osteosarcoma -1.068 3.2e-03

Gene RIF (2)

AA Sequence

MSLGLLKFQAVGEEDEEDEEGESLDSVKALTAKLQLQTRRPSYLEWTAQVQSQAWRRAQAKPGPGGPGDI      1 - 70
CGFDSMDSALEWLRRELREMQAQDRQLAGQLLRLRAQLHRLKMDQACHLHQELLDEAELELELEPGAGLA     71 - 140
LAPLLRHLGLTRMNISARRFTLC                                                   141 - 163
//

Text Mined References (5)

PMID Year Title