Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.36
PubTator Score 2.93

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

AA Sequence

MAGTGLLALRTLPGPSWVRGSGPSVLSRLQDAAVVRPGFLSTAEEETLSRELEPELRRRRYEYDHWDAAI      1 - 70
HGFRETEKSRWSEASRAILQRVQAAAFGPGQTLLSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSP     71 - 140
SVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEILRDEESFFGERRIPRGRRISVICRSLPEGMG    141 - 210
PGESGQPPPAC                                                               211 - 221
//

Text Mined References (13)

PMID Year Title