Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.38
PubTator Score 2.93

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BT30 B2R4U9 Q53FF3
Symbols ABH7
SPATA11
UNQ6002

Gene

PDB

4QKB   4QKD   4QKF  

Gene RIF (2)

PMID Text
25122757 ALKBH7 possesses the conserved double-stranded beta-helix fold that coordinates a catalytically active iron by a conserved HX(D/E) em leader Xn em leader H motif.
23666923 novel role for a AlkB homolog, human ALKBH7, in programmed necrosis, presenting a new target for therapeutic intervention in cancer cells that are resistant to apoptotic cell death

AA Sequence

MAGTGLLALRTLPGPSWVRGSGPSVLSRLQDAAVVRPGFLSTAEEETLSRELEPELRRRRYEYDHWDAAI      1 - 70
HGFRETEKSRWSEASRAILQRVQAAAFGPGQTLLSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSP     71 - 140
SVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEILRDEESFFGERRIPRGRRISVICRSLPEGMG    141 - 210
PGESGQPPPAC                                                               211 - 221
//

Text Mined References (12)

PMID Year Title
25122757 2014 The atomic resolution structure of human AlkB homolog 7 (ALKBH7), a key protein for programmed necrosis and fat metabolism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23666923 2013 Human ALKBH7 is required for alkylation and oxidation-induced programmed necrosis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
17979886 Expression and sub-cellular localization of human ABH family molecules.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...