Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.38
PubTator Score 2.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ulcerative colitis 2087 4.3829447868663E-6
ovarian cancer 8492 5.89188612295336E-5
pancreatic ductal adenocarcinoma liver metastasis 1795 3.14603273114518E-4
diabetes mellitus 1663 0.00407023745858525
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00674190470656184
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00868783223301042
group 3 medulloblastoma 2254 0.00958440258250184
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0187042730392157

Expression

Synonym

Accession Q9BT30 B2R4U9 Q53FF3
Symbols ABH7
SPATA11
UNQ6002

Gene

PDB

4QKB   4QKD   4QKF  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (2)

PMID Text
25122757 ALKBH7 possesses the conserved double-stranded beta-helix fold that coordinates a catalytically active iron by a conserved HX(D/E) em leader Xn em leader H motif.
23666923 novel role for a AlkB homolog, human ALKBH7, in programmed necrosis, presenting a new target for therapeutic intervention in cancer cells that are resistant to apoptotic cell death

AA Sequence

MAGTGLLALRTLPGPSWVRGSGPSVLSRLQDAAVVRPGFLSTAEEETLSRELEPELRRRRYEYDHWDAAI      1 - 70
HGFRETEKSRWSEASRAILQRVQAAAFGPGQTLLSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSP     71 - 140
SVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEILRDEESFFGERRIPRGRRISVICRSLPEGMG    141 - 210
PGESGQPPPAC                                                               211 - 221
//

Text Mined References (12)

PMID Year Title
25122757 2014 The atomic resolution structure of human AlkB homolog 7 (ALKBH7), a key protein for programmed necrosis and fat metabolism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23666923 2013 Human ALKBH7 is required for alkylation and oxidation-induced programmed necrosis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
17979886 Expression and sub-cellular localization of human ABH family molecules.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...