Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.11
PubTator Score 3.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 3.0e-04
group 3 medulloblastoma 4104 3.6e-04

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.400 3.6e-04
osteosarcoma -1.127 3.0e-04

Protein-protein Interaction (1)

Gene RIF (4)

AA Sequence

MADSSGRGAGKPATGPTNSSSAKKKDKRVQGGRVIESRYLQYEKKTTQKAPAGDGSQTRGKMSEGGRKSS      1 - 70
LLQKSKADSSGVGKGDLQSTLLEGHGTAPPDLDLSAINDKSIVKKTPQLAKTISKKPESTSFSAPRKKSP     71 - 140
DLSEAMEMMESQTLLLTLLSVKMENNLAEFERRAEKNLLIMCKEKEKLQKKAHELKRRLLLSQRKRELAD    141 - 210
VLDAQIEMLSPFEAVATRFKEQYRTFATALDTTRHELPVRSIHLEGDGQQLLDALQHELVTTQRLLGELD    211 - 280
VGDSEENVQVLDLLSELKDVTAKKDLELRRSFAQVLELSAEASKEAALANQEVWEETQGMAPPSRWYFNQ    281 - 350
DSACRESGGAPKNTPLSEDDNPGASSAPAQATFISPSEDFSSSSQAEVPPSLSRSGRDLS              351 - 410
//

Text Mined References (17)

PMID Year Title