Property Summary

NCBI Gene PubMed Count 10
Grant Count 6
Funding $530,160.75
PubMed Score 0.07
PubTator Score 3.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.127 0.000
group 3 medulloblastoma 1.400 0.000

Gene RIF (4)

PMID Text
25173975 Hice1 and hDgt6 are core components of distinct augmin sub-complexes.
21705324 Aurora-A modulates the microtubule binding activity of Hice1 in a spatiotemporal manner for proper bipolar spindle assembly.
19776357 Results suggest that Hec1, through cooperation with Hice1, contributes to centrosome-directed microtubule growth to facilitate establishing a proper mitotic spindle.
18362163 Hice1 is a novel microtubule-associated protein important for maintaining spindle integrity and chromosomal stability, in part by virtue of its ability to bind, bundle, and stabilize microtubules.

AA Sequence

MADSSGRGAGKPATGPTNSSSAKKKDKRVQGGRVIESRYLQYEKKTTQKAPAGDGSQTRGKMSEGGRKSS      1 - 70
LLQKSKADSSGVGKGDLQSTLLEGHGTAPPDLDLSAINDKSIVKKTPQLAKTISKKPESTSFSAPRKKSP     71 - 140
DLSEAMEMMESQTLLLTLLSVKMENNLAEFERRAEKNLLIMCKEKEKLQKKAHELKRRLLLSQRKRELAD    141 - 210
VLDAQIEMLSPFEAVATRFKEQYRTFATALDTTRHELPVRSIHLEGDGQQLLDALQHELVTTQRLLGELD    211 - 280
VGDSEENVQVLDLLSELKDVTAKKDLELRRSFAQVLELSAEASKEAALANQEVWEETQGMAPPSRWYFNQ    281 - 350
DSACRESGGAPKNTPLSEDDNPGASSAPAQATFISPSEDFSSSSQAEVPPSLSRSGRDLS              351 - 410
//

Text Mined References (16)

PMID Year Title
25173975 2014 Reconstitution of the augmin complex provides insights into its architecture and function.
21705324 2011 Aurora-A phosphorylates Augmin complex component Hice1 protein at an N-terminal serine/threonine cluster to modulate its microtubule binding activity during spindle assembly.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
19776357 2009 Hec1 contributes to mitotic centrosomal microtubule growth for proper spindle assembly through interaction with Hice1.
19427217 2009 HAUS, the 8-subunit human Augmin complex, regulates centrosome and spindle integrity.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369198 2009 The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18443220 2008 Augmin: a protein complex required for centrosome-independent microtubule generation within the spindle.
More...