Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.85
PubTator Score 10.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.361 0.000

Synonym

Accession Q9BT17 Q5VWX8 Q6PIY9 Q8IYJ4 Q8NC48 Q9BVU8
Symbols GTP
GTPBP7

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
23396448 The results suggested that Mtg1 functions with the large subunit of the mitochondrial ribosome, and are involved in both the translation and assembly of respiratory complexes.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRLTPRALCSAAQAAWRENFPLCGRDVARWFPGHMAKGLKKMQSSLKLVDCIIEVHDARIPLSGRNPLFQ      1 - 70
ETLGLKPHLLVLNKMDLADLTEQQKIMQHLEGEGLKNVIFTNCVKDENVKQIIPMVTELIGRSHRYHRKE     71 - 140
NLEYCIMVIGVPNVGKSSLINSLRRQHLRKGKATRVGGEPGITRAVMSKIQVSERPLMFLLDTPGVLAPR    141 - 210
IESVETGLKLALCGTVLDHLVGEETMADYLLYTLNKHQRFGYVQHYGLGSACDNVERVLKSVAVKLGKTQ    211 - 280
KVKVLTGTGNVNIIQPNYPAAARDFLQTFRRGLLGSVMLDLDVLRGHPPAETLP                    281 - 334
//

Publication (13)

PMID Year Title
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
23396448 2013 Human G-proteins, ObgH1 and Mtg1, associate with the large mitochondrial ribosome subunit and are involved in translation and assembly of respiratory complexes.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18482256 2009 Protein microarray analysis identifies human cellular prion protein interactors.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342797 2004 Evolution of vertebrate genes related to prion and Shadoo proteins--clues from comparative genomic analysis.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...