Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.05
PubTator Score 4.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 1.2e-04
group 3 medulloblastoma 1.300 3.3e-03
non primary Sjogren syndrome sicca 1.100 2.9e-02
ovarian cancer 1.300 2.1e-05

Protein-protein Interaction (8)

Gene RIF (1)

AA Sequence

MDSMPEPASRCLLLLPLLLLLLLLLPAPELGPSQAGAEENDWVRLPSKCEVCKYVAVELKSAFEETGKTK      1 - 70
EVIGTGYGILDQKASGVKYTKSDLRLIEVTETICKRLLDYSLHKERTGSNRFAKGMSETFETLHNLVHKG     71 - 140
VKVVMDIPYELWNETSAEVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTEFLCANHVLKGKDTSCLAEQ    141 - 210
WSGKKGDTAALGGKKSKKKSSRAKAAGGRSSSSKQRKELGGLEGDPSPEEDEGIQKASPLTHSPPDEL      211 - 278
//

Text Mined References (20)

PMID Year Title