Property Summary

NCBI Gene PubMed Count 14
Grant Count 10
R01 Count 4
Funding $1,031,937.43
PubMed Score 3.74
PubTator Score 4.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.300 0.003
non primary Sjogren syndrome sicca 1.100 0.029
ovarian cancer 1.300 0.000

Gene RIF (1)

PMID Text
22447933 a mechanism for the differential trafficking of TLR1 I602S variants, and highlight the distinct roles for PRAT4A and PRAT4B in the regulation of TLR1 surface expression.

AA Sequence

MDSMPEPASRCLLLLPLLLLLLLLLPAPELGPSQAGAEENDWVRLPSKCEVCKYVAVELKSAFEETGKTK      1 - 70
EVIGTGYGILDQKASGVKYTKSDLRLIEVTETICKRLLDYSLHKERTGSNRFAKGMSETFETLHNLVHKG     71 - 140
VKVVMDIPYELWNETSAEVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTEFLCANHVLKGKDTSCLAEQ    141 - 210
WSGKKGDTAALGGKKSKKKSSRAKAAGGRSSSSKQRKELGGLEGDPSPEEDEGIQKASPLTHSPPDEL      211 - 278
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23803655 2013 Toll-like receptor and accessory molecule mRNA expression in humans and mice as well as in murine autoimmunity, transient inflammation, and progressive fibrosis.
22836022 2012 PRAT4A-dependent expression of cell surface TLR5 on neutrophils, classical monocytes and dendritic cells.
22447933 2012 Cell surface trafficking of TLR1 is differentially regulated by the chaperones PRAT4A and PRAT4B.
21269460 2011 Initial characterization of the human central proteome.
20865800 2010 Folding of Toll-like receptors by the HSP90 paralogue gp96 requires a substrate-specific cochaperone.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18780723 2008 A single base mutation in the PRAT4A gene reveals differential interaction of PRAT4A with Toll-like receptors.
17998391 2007 A protein associated with Toll-like receptor (TLR) 4 (PRAT4A) is required for TLR-dependent immune responses.
More...