Property Summary

NCBI Gene PubMed Count 16
Grant Count 5
R01 Count 5
Funding $625,175.67
PubMed Score 3.72
PubTator Score 3.80

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
25475730 endothelial cells contain a long variant of CRACR2A which is an EF-hand-containing Rab protein that lacks impact on CRAC channels
20708005 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20418871 CRACR2A interacts directly with Orai1 and STIM1, forming a ternary complex that dissociates at elevated Ca(2+) concentrations; is a key regulator of CRAC channel-mediated SOCE
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAAPDGRVVSRPQRLGQGSGQGPKGSGACLHPLDSLEQKETQEQTSGQLVMLRKAQEFFQTCDAEGKGFI      1 - 70
ARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQNNPSQEDAGEQVAQRHEEKV     71 - 140
YLSRGDEDLGDMGEDEEAQFRMLMDRLGAQKVLEDESDVKQLWLQLKKEEPHLLSNFEDFLTRIISQLQE    141 - 210
AHEEKNELECALKRKIAAYDEEIQHLYEEMEQQIKSEKEQFLLKDTERFQARSQELEQKLLCKEQELEQL    211 - 280
TQKQKRLEGQCTALHHDKHETKAENTKLKLTNQELARELERTSWELQDAQQQLESLQQEACKLHQEKEME    281 - 350
VYRVTESLQREKAGLLKQLDFLRCVGGHWPVLRAPPRSLGSEGPV                             351 - 395
//

Publication (17)

PMID Year Title
25475730 2015 Expression of a long variant of CRACR2A that belongs to the Rab GTPase protein family in endothelial cells.
25416956 2014 A proteome-scale map of the human interactome network.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
21993531 2012 Genome-wide association study does not reveal major genetic determinants for anti-cytomegalovirus antibody response.
20708005 2010 Genome-wide association study identifies variants associated with histologic features of nonalcoholic Fatty liver disease.
20418871 2010 A novel EF-hand protein, CRACR2A, is a cytosolic Ca2+ sensor that stabilizes CRAC channels in T cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
19478329 Genome-wide study of single-nucleotide polymorphisms associated with azoospermia and severe oligozoospermia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...