Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.01
PubTator Score 4.17

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.400 0.001
astrocytoma 1.100 0.010
glioblastoma 1.200 0.024
atypical teratoid / rhabdoid tumor 1.300 0.000
pediatric high grade glioma 1.100 0.000
ovarian cancer 1.300 0.000

Synonym

Accession Q9BSV6 A6NNB1 B0V3J1 Q9BVT1 Q9H6H5
Symbols LENG5
PCH2C
SEN34
SEN34L

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

AA Sequence

MLVVEVANGRSLVWGAEAVQALRERLGVGGRTVGALPRGPRQNSRLGLPLLLMPEEARLLAEIGAVTLVS      1 - 70
APRPDSRHHSLALTSFKRQQEESFQEQSALAAEARETRRQELLEKITEGQAAKKQKLEQASGASSSQEAG     71 - 140
SSQAAKEDETSDGQASGEQEEAGPSSSQAGPSNGVAPLPRSALLVQLATARPRPVKARPLDWRVQSKDWP    141 - 210
HAGRPAHELRYSIYRDLWERGFFLSAAGKFGGDFLVYPGDPLRFHAHYIAQCWAPEDTIPLQDLVAAGRL    211 - 280
GTSVRKTLLLCSPQPDGKVVYTSLQWASLQ                                            281 - 310
//

Text Mined References (15)

PMID Year Title
23562994 2013 Pontocerebellar hypoplasia type 2 and TSEN2: review of the literature and two novel mutations.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18711368 2008 tRNA splicing endonuclease mutations cause pontocerebellar hypoplasia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15109492 2004 Identification of a human endonuclease complex reveals a link between tRNA splicing and pre-mRNA 3' end formation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
More...