Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.30
PubTator Score 4.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.100 9.9e-03
atypical teratoid / rhabdoid tumor 1.300 1.2e-07
glioblastoma 1.200 2.4e-02
ovarian cancer 1.300 3.0e-04
pediatric high grade glioma 1.100 1.8e-07
psoriasis 1.400 5.3e-04

AA Sequence

MLVVEVANGRSLVWGAEAVQALRERLGVGGRTVGALPRGPRQNSRLGLPLLLMPEEARLLAEIGAVTLVS      1 - 70
APRPDSRHHSLALTSFKRQQEESFQEQSALAAEARETRRQELLEKITEGQAAKKQKLEQASGASSSQEAG     71 - 140
SSQAAKEDETSDGQASGEQEEAGPSSSQAGPSNGVAPLPRSALLVQLATARPRPVKARPLDWRVQSKDWP    141 - 210
HAGRPAHELRYSIYRDLWERGFFLSAAGKFGGDFLVYPGDPLRFHAHYIAQCWAPEDTIPLQDLVAAGRL    211 - 280
GTSVRKTLLLCSPQPDGKVVYTSLQWASLQ                                            281 - 310
//

Text Mined References (15)

PMID Year Title