Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.01
PubTator Score 4.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.400 0.001
astrocytoma 1.100 0.010
glioblastoma 1.200 0.024
atypical teratoid / rhabdoid tumor 1.300 0.000
pediatric high grade glioma 1.100 0.000
ovarian cancer 1.300 0.000

Synonym

Accession Q9BSV6 A6NNB1 B0V3J1 Q9BVT1 Q9H6H5
Symbols LENG5
PCH2C
SEN34
SEN34L

Gene

AA Sequence

MLVVEVANGRSLVWGAEAVQALRERLGVGGRTVGALPRGPRQNSRLGLPLLLMPEEARLLAEIGAVTLVS      1 - 70
APRPDSRHHSLALTSFKRQQEESFQEQSALAAEARETRRQELLEKITEGQAAKKQKLEQASGASSSQEAG     71 - 140
SSQAAKEDETSDGQASGEQEEAGPSSSQAGPSNGVAPLPRSALLVQLATARPRPVKARPLDWRVQSKDWP    141 - 210
HAGRPAHELRYSIYRDLWERGFFLSAAGKFGGDFLVYPGDPLRFHAHYIAQCWAPEDTIPLQDLVAAGRL    211 - 280
GTSVRKTLLLCSPQPDGKVVYTSLQWASLQ                                            281 - 310
//

Text Mined References (15)

PMID Year Title
23562994 2013 Pontocerebellar hypoplasia type 2 and TSEN2: review of the literature and two novel mutations.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18711368 2008 tRNA splicing endonuclease mutations cause pontocerebellar hypoplasia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15109492 2004 Identification of a human endonuclease complex reveals a link between tRNA splicing and pre-mRNA 3' end formation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
More...