Property Summary

NCBI Gene PubMed Count 59
PubMed Score 76.08
PubTator Score 72.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Astrocytoma, Pilocytic -1.100 1.6e-07
atypical teratoid / rhabdoid tumor -1.200 1.3e-06
ependymoma -1.100 8.5e-08
medulloblastoma, large-cell -1.700 1.8e-05
ovarian cancer 1.400 4.5e-06
pancreatic ductal adenocarcinoma liver m... -1.224 5.8e-03

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (42)

AA Sequence

MEEEGKKGKKPGIVSPFKRVFLKGEKSRDKKAHEKVTERRPLHTVVLSLPERVEPDRLLSDYIEKEVKYL      1 - 70
GQLTSIPGYLNPSSRTEILHFIDNAKRAHQLPGHLTQEHDAVLSLSAYNVKLAWRDGEDIILRVPIHDIA     71 - 140
AVSYVRDDAAHLVVLKTAQDPGISPSQSLCAESSRGLSAGSLSESAVGPVEACCLVILAAESKVAAEELC    141 - 210
CLLGQVFQVVYTESTIDFLDRAIFDGASTPTHHLSLHSDDSSTKVDIKETYEVEASTFCFPESVDVGGAS    211 - 280
PHSKTISESELSASATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINLRQLYGDSRKFLL    281 - 350
LGLRPFIPEKDSQHFENFLETIGVKDGRGIITDSFGRHRRALSTTSSSTTNGNRATGSSDDRSAPSEGDE    351 - 420
WDRMISDISSDIEALGCSMDQDSA                                                  421 - 444
//

Text Mined References (61)

PMID Year Title