Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.41
PubTator Score 2.25

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.600 1.0e-05
ependymoma 1.100 1.0e-05
glioblastoma 1.200 4.9e-03
group 3 medulloblastoma 1.400 7.9e-05
hepatocellular carcinoma 1.200 2.0e-05
medulloblastoma, large-cell 1.100 3.8e-04
osteosarcoma 1.294 3.5e-05
primitive neuroectodermal tumor 1.200 1.1e-05
tuberculosis and treatment for 6 months -1.400 7.4e-05

AA Sequence

MSDNPPRMEVCPYCKKPFKRLKSHLPYCKMIGPTIPTDQKVYQSKPATLPRAKKMKGPIKDLIKAKGKEL      1 - 70
ETENEERNSKLVVDKPEQTVKTFPLPAVGLERAATTKADKDIKNPIQPSFKMLKNTKPMTTFQEETKAQF     71 - 140
YASEKTSPKRELAKDLPKSGESRCNPSEAGASLLVGSIEPSLSNQDRKYSSTLPNDVQTTSGDLKLDKID    141 - 210
PQRQELLVKLLDVPTGDCHISPKNVSDGVKRVRTLLSNERDSKGRDHLSGVPTDVTVTETPEKNTESLIL    211 - 280
SLKMSSLGKIQVMEKQEKGLTLGVETCGSKGNAEKSMSATEKQERTVMSHGCENFNTRDSVTGKESQGER    281 - 350
PHLSLFIPRETTYQFHSVSQSSSQSLASLATTFLQEKKAEAQNHHCVPDVKALMESPEGQLSLEPKSDSQ    351 - 420
FQASHTGCQSPLCSAQRHTPQSPFTNHAAAAGRKTLRSCMGLEWFPELYPGYLGLGVLPGKPQCWNAMTQ    421 - 490
KPQLISPQGERLSQVSLLERSSTHIRSLEPPAGLTTSNFSLMRLLGAVQKGWIRCNTTIRKSGFGGITML    491 - 560
FTGYFVLCCSWSFRRLKKLCRPLPWKSTVPPCIGVAKTTGDCRSKTCLD                         561 - 609
//

Text Mined References (11)

PMID Year Title