Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.16
PubTator Score 2.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
medulloblastoma, large-cell 6234 5.45467942600969E-6
group 4 medulloblastoma 1875 6.84832201167139E-6
atypical teratoid / rhabdoid tumor 4369 1.00352961428328E-5
primitive neuroectodermal tumor 3031 1.14171817645714E-5
hepatocellular carcinoma 550 1.98596428355439E-5
posterior fossa group B ependymoma 1530 2.03825648069351E-5
tuberculosis and treatment for 6 months 686 7.41174007376E-5
osteosarcoma 7933 9.59499802119374E-5
glioblastoma 5572 0.00493142608480123
Disease Target Count Z-score Confidence
Poliomyelitis 11 4.082 2.0

Expression

Synonym

Accession Q9BSJ5 A8K9X3 Q5JB45 Q6YAU3 Q9H0L9 Q9H5E6 Q9NWN5
Symbols MIG3
HLC-8
SPEP1

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG

AA Sequence

MSDNPPRMEVCPYCKKPFKRLKSHLPYCKMIGPTIPTDQKVYQSKPATLPRAKKMKGPIKDLIKAKGKEL      1 - 70
ETENEERNSKLVVDKPEQTVKTFPLPAVGLERAATTKADKDIKNPIQPSFKMLKNTKPMTTFQEETKAQF     71 - 140
YASEKTSPKRELAKDLPKSGESRCNPSEAGASLLVGSIEPSLSNQDRKYSSTLPNDVQTTSGDLKLDKID    141 - 210
PQRQELLVKLLDVPTGDCHISPKNVSDGVKRVRTLLSNERDSKGRDHLSGVPTDVTVTETPEKNTESLIL    211 - 280
SLKMSSLGKIQVMEKQEKGLTLGVETCGSKGNAEKSMSATEKQERTVMSHGCENFNTRDSVTGKESQGER    281 - 350
PHLSLFIPRETTYQFHSVSQSSSQSLASLATTFLQEKKAEAQNHHCVPDVKALMESPEGQLSLEPKSDSQ    351 - 420
FQASHTGCQSPLCSAQRHTPQSPFTNHAAAAGRKTLRSCMGLEWFPELYPGYLGLGVLPGKPQCWNAMTQ    421 - 490
KPQLISPQGERLSQVSLLERSSTHIRSLEPPAGLTTSNFSLMRLLGAVQKGWIRCNTTIRKSGFGGITML    491 - 560
FTGYFVLCCSWSFRRLKKLCRPLPWKSTVPPCIGVAKTTGDCRSKTCLD                         561 - 609
//

Text Mined References (11)

PMID Year Title
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
More...