Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.57
PubTator Score 4.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Leigh disease 100 4.389 2.2
Cytochrome-c Oxidase Deficiency 17 0.0 0.0

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.700 1.5e-04
non primary Sjogren syndrome sicca 1.100 2.6e-02
osteosarcoma -1.337 1.8e-05
pancreatic ductal adenocarcinoma liver m... -1.318 1.2e-02

Gene RIF (3)

AA Sequence

MSAWAAASLSRAAARCLLARGPGVRAAPPRDPRPSHPEPRGCGAAPGRTLHFTAAVPAGHNKWSKVRHIK      1 - 70
GPKDVERSRIFSKLCLNIRLAVKEGGPNPEHNSNLANILEVCRSKHMPKSTIETALKMEKSKDTYLLYEG     71 - 140
RGPGGSSLLIEALSNSSHKCQADIRHILNKNGGVMAVGARHSFDKKGVIVVEVEDREKKAVNLERALEMA    141 - 210
IEAGAEDVKETEDEEERNVFKFICDASSLHQVRKKLDSLGLCSVSCALEFIPNSKVQLAEPDLEQAAHLI    211 - 280
QALSNHEDVIHVYDNIE                                                         281 - 297
//

Text Mined References (13)

PMID Year Title