Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.55
PubTator Score 8.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.1858104020688E-6
osteosarcoma 7933 2.45398661271302E-6
glioblastoma 5572 6.52241716501218E-6
pediatric high grade glioma 2712 7.51432058965603E-6
medulloblastoma 1524 1.53434834738405E-5
medulloblastoma, large-cell 6234 6.39202709059898E-5
ovarian cancer 8492 4.53080710504766E-4
inflammatory breast cancer 404 0.00179021335466651
astrocytic glioma 2241 0.00854259424192267
ependymoma 2514 0.0431120616701967
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0
Disease Target Count Z-score Confidence
Glycine encephalopathy 28 4.44 2.2

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.100 0.009
ependymoma -1.100 0.043
osteosarcoma -1.565 0.000
medulloblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.400 0.000
medulloblastoma, large-cell -2.000 0.000
pediatric high grade glioma -1.100 0.000
inflammatory breast cancer -1.100 0.002
ovarian cancer 1.100 0.000

Synonym

Accession Q9BSH3 Q8IZQ2
Symbols

Gene

  Ortholog (6)

Species Source
Macaque EggNOG Inparanoid
Mouse EggNOG Inparanoid
Rat EggNOG Inparanoid
Cow EggNOG Inparanoid
Anole lizard EggNOG Inparanoid
Xenopus EggNOG Inparanoid

Gene RIF (3)

PMID Text
20821255 results provide important clues to elucidate the regulation of NPCEDRG gene expression and function
20307617 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSRVLVPCHVKGSVALQVGDVRTSQGRPGVLVIDVTFPSVAPFELQEITFKNYYTAFLSIRVRQYTSAHT      1 - 70
PAKWVTCLRDYCLMPDPHSEEGAQEYVSLFKHQMLCDMARISELRLILRQPSPLWLSFTVEELQIYQQGP     71 - 140
KSPSVTFPKWLSHPVPCEQPALLREGLPDPSRVSSEVQQMWALTEMIRASHTSARIGRFDVDGCYDLNLL    141 - 210
SYT                                                                       211 - 213
//

Text Mined References (8)

PMID Year Title
20821255 2011 Cloning and characterization of the NPCEDRG gene promoter.
20307617 2010 Association analysis of 3p21 with Crohn's disease in a New Zealand population.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12487019 2002 Genomic organization of the murine aminomethyltransferase gene (Amt).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12392556 2002 Cloning and characterization of the mammalian-specific nicolin 1 gene (NICN1) encoding a nuclear 24 kDa protein.