Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.55
PubTator Score 8.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.100 0.009
ependymoma -1.100 0.043
osteosarcoma -1.565 0.000
medulloblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.400 0.000
medulloblastoma, large-cell -2.000 0.000
pediatric high grade glioma -1.100 0.000
inflammatory breast cancer -1.100 0.002
ovarian cancer 1.100 0.000

Gene RIF (3)

PMID Text
20821255 results provide important clues to elucidate the regulation of NPCEDRG gene expression and function
20307617 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSRVLVPCHVKGSVALQVGDVRTSQGRPGVLVIDVTFPSVAPFELQEITFKNYYTAFLSIRVRQYTSAHT      1 - 70
PAKWVTCLRDYCLMPDPHSEEGAQEYVSLFKHQMLCDMARISELRLILRQPSPLWLSFTVEELQIYQQGP     71 - 140
KSPSVTFPKWLSHPVPCEQPALLREGLPDPSRVSSEVQQMWALTEMIRASHTSARIGRFDVDGCYDLNLL    141 - 210
SYT                                                                       211 - 213
//

Text Mined References (8)

PMID Year Title
20821255 2011 Cloning and characterization of the NPCEDRG gene promoter.
20307617 2010 Association analysis of 3p21 with Crohn's disease in a New Zealand population.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12487019 2002 Genomic organization of the murine aminomethyltransferase gene (Amt).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12392556 2002 Cloning and characterization of the mammalian-specific nicolin 1 gene (NICN1) encoding a nuclear 24 kDa protein.