Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.49
PubTator Score 8.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.100 8.5e-03
atypical teratoid / rhabdoid tumor -1.400 1.2e-06
ependymoma -1.100 4.3e-02
glioblastoma -1.400 6.5e-06
group 4 medulloblastoma -1.200 1.7e-04
inflammatory breast cancer -1.100 1.8e-03
medulloblastoma, large-cell -2.000 6.4e-05
osteosarcoma -1.565 2.5e-06
ovarian cancer 1.100 4.5e-04
pediatric high grade glioma -1.100 7.5e-06

Synonym

Accession Q9BSH3 Q8IZQ2
Symbols

Gene

  Ortholog (1)

Species Source Disease
Macaque EggNOG Inparanoid

Gene RIF (3)

AA Sequence

MSRVLVPCHVKGSVALQVGDVRTSQGRPGVLVIDVTFPSVAPFELQEITFKNYYTAFLSIRVRQYTSAHT      1 - 70
PAKWVTCLRDYCLMPDPHSEEGAQEYVSLFKHQMLCDMARISELRLILRQPSPLWLSFTVEELQIYQQGP     71 - 140
KSPSVTFPKWLSHPVPCEQPALLREGLPDPSRVSSEVQQMWALTEMIRASHTSARIGRFDVDGCYDLNLL    141 - 210
SYT                                                                       211 - 213
//

Text Mined References (8)

PMID Year Title