Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.67
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
ependymoma 4679 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 1.1e-08
osteosarcoma 7950 5.0e-06

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.225 5.0e-06
ovarian cancer 1.400 1.1e-08

Gene RIF (1)

AA Sequence

MDCRVHMRPIGLTWVLQLTLAWILLEACGGSRPLQARSQQHHGLAADLGKGKLHLAGPCCPSEMDTTETS      1 - 70
GPGNHPERCGVPSPECESFLEHLQRALRSRFRLRLLGVRQAQPLCEELCQAWFANCEDDITCGPTWLPLS     71 - 140
EKRGCEPSCLTYGQTFADGTDLCRSALGHALPVAAPGARHCFNISISAVPRPRPGRRGREAPSRRSRSPR    141 - 210
TSILDAAGSGSGSGSGSGP                                                       211 - 229
//

Text Mined References (12)

PMID Year Title