Property Summary

NCBI Gene PubMed Count 10
PubMed Score 16.51
PubTator Score 3.74

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BS16 Q9H4L0 CENP-K
Symbols P33
Solt
CENP-K
FKSG14
AF5alpha

Gene

Gene RIF (2)

PMID Text
23898208 HIV-1 Tat downregulates the expression of centromere protein K (CENPK) in human primary T cells
18045986 the vertebrate KNL1 counterpart is essential for chromosome segregation and is required to localize a subset of outer kinetochore proteins.

AA Sequence

MNQEDLDPDSTTDVGDVTNTEEELIRECEEMWKDMEECQNKLSLIGTETLTDSNAQLSLLIMQVKCLTAE      1 - 70
LSQWQKKTPETIPLTEDVLITLGKEEFQKLRQDLEMVLSTKESKNEKLKEDLEREQRWLDEQQQIMESLN     71 - 140
VLHSELKNKVETFSESRIFNELKTKMLNIKEYKEKLLSTLGEFLEDHFPLPDRSVKKKKKNIQESSVNLI    141 - 210
TLHEMLEILINRLFDVPHDPYVKISDSFWPPYVELLLRNGIALRHPEDPTRIRLEAFHQ               211 - 269
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19381461 2009 CENP-K and CENP-H may form coiled-coils in the kinetochores.
18045986 2008 KNL1 and the CENP-H/I/K complex coordinately direct kinetochore assembly in vertebrates.
16716197 2006 Comprehensive analysis of the ICEN (Interphase Centromere Complex) components enriched in the CENP-A chromatin of human cells.
16622420 2006 The CENP-H-I complex is required for the efficient incorporation of newly synthesized CENP-A into centromeres.
16622419 2006 The human CENP-A centromeric nucleosome-associated complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15009096 2004 Proteomics analysis of the centromere complex from HeLa interphase cells: UV-damaged DNA binding protein 1 (DDB-1) is a component of the CEN-complex, while BMI-1 is transiently co-localized with the centromeric region in interphase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10996314 2000 Characterization of Solt, a novel SoxLZ/Sox6 binding protein expressed in adult mouse testis.
More...