Property Summary

NCBI Gene PubMed Count 10
PubMed Score 16.64
PubTator Score 3.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
active Crohn's disease 1.151 1.5e-02
adrenocortical carcinoma 2.655 8.0e-07
adult high grade glioma 2.900 4.1e-05
Atopic dermatitis 1.200 2.0e-04
atypical teratoid / rhabdoid tumor 3.200 7.1e-10
Breast cancer 1.700 1.2e-08
breast carcinoma 1.100 2.3e-28
cystic fibrosis and chronic rhinosinusit... 1.138 2.2e-02
ductal carcinoma in situ 1.600 4.3e-03
Endometriosis 1.534 4.4e-02
ependymoma 1.400 1.4e-04
glioblastoma 3.300 4.6e-11
group 3 medulloblastoma 2.900 1.3e-05
interstitial cystitis 1.700 7.7e-03
intraductal papillary-mucinous carcinoma... 2.500 3.5e-04
intraductal papillary-mucinous neoplasm ... 4.100 1.1e-04
invasive ductal carcinoma 1.700 1.1e-02
lung adenocarcinoma 1.100 5.4e-08
medulloblastoma, large-cell 3.200 2.8e-07
nasopharyngeal carcinoma 1.500 9.3e-06
non primary Sjogren syndrome sicca -1.100 3.1e-02
non-small cell lung cancer 1.815 9.8e-25
oligodendroglioma 1.300 2.3e-05
ovarian cancer 2.100 3.5e-05
pancreatic cancer 1.900 8.5e-06
primitive neuroectodermal tumor 3.100 2.5e-06
psoriasis 1.800 4.2e-12

Gene RIF (2)

AA Sequence

MNQEDLDPDSTTDVGDVTNTEEELIRECEEMWKDMEECQNKLSLIGTETLTDSNAQLSLLIMQVKCLTAE      1 - 70
LSQWQKKTPETIPLTEDVLITLGKEEFQKLRQDLEMVLSTKESKNEKLKEDLEREQRWLDEQQQIMESLN     71 - 140
VLHSELKNKVETFSESRIFNELKTKMLNIKEYKEKLLSTLGEFLEDHFPLPDRSVKKKKKNIQESSVNLI    141 - 210
TLHEMLEILINRLFDVPHDPYVKISDSFWPPYVELLLRNGIALRHPEDPTRIRLEAFHQ               211 - 269
//

Text Mined References (11)

PMID Year Title