Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.78
PubTator Score 3.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute quadriplegic myopathy 1.059 6.1e-08
adult high grade glioma 1.300 1.8e-02
astrocytoma 1.300 1.4e-11
Astrocytoma, Pilocytic 1.600 3.7e-05
cystic fibrosis -1.037 4.5e-04
ependymoma 1.200 1.2e-08
gastric cancer 1.300 6.7e-04
glioblastoma 1.400 3.3e-03
group 4 medulloblastoma -1.400 4.4e-03
hepatocellular carcinoma 1.200 2.0e-06
invasive ductal carcinoma -1.200 2.0e-04
juvenile dermatomyositis 1.237 2.6e-13
lung cancer -1.400 3.2e-02
medulloblastoma, large-cell -1.300 5.5e-03
osteosarcoma -2.460 3.4e-05
ovarian cancer -1.100 1.5e-03
pancreatic ductal adenocarcinoma liver m... 1.098 4.5e-02
subependymal giant cell astrocytoma 1.778 2.1e-02

Gene RIF (8)

AA Sequence

MVSHGSSPSLLEALSSDFLACKICLEQLRAPKTLPCLHTYCQDCLAQLADGGRVRCPECRETVPVPPEGV      1 - 70
ASFKTNFFVNGLLDLVKARACGDLRAGKPACALCPLVGGTSTGGPATARCLDCADDLCQACADGHRCTRQ     71 - 140
THTHRVVDLVGYRAGWYDEEARERQAAQCPQHPGEALRFLCQPCSQLLCRECRLDPHLDHPCLPLAEAVR    141 - 210
ARRPGLEGLLAGVDNNLVELEAARRVEKEALARLREQAARVGTQVEEAAEGVLRALLAQKQEVLGQLRAH    211 - 280
VEAAEEAARERLAELEGREQVARAAAAFARRVLSLGREAEILSLEGAIAQRLRQLQGCPWAPGPAPCLLP    281 - 350
QLELHPGLLDKNCHLLRLSFEEQQPQKDGGKDGAGTQGGEESQSRREDEPKTERQGGVQPQAGDGAQTPK    351 - 420
EEKAQTTREEGAQTLEEDRAQTPHEDGGPQPHRGGRPNKKKKFKGRLKSISREPSPALGPNLDGSGLLPR    421 - 490
PIFYCSFPTRMPGDKRSPRITGLCPFGPREILVADEQNRALKRFSLNGDYKGTVPVPEGCSPCSVAALQS    491 - 560
AVAFSASARLYLINPNGEVQWRRALSLSQASHAVAALPSGDRVAVSVAGHVEVYNMEGSLATRFIPGGKA    561 - 630
SRGLRALVFLTTSPQGHFVGSDWQQNSVVICDGLGQVVGEYKGPGLHGCQPGSVSVDKKGYIFLTLREVN    631 - 700
KVVILDPKGSLLGDFLTAYHGLEKPRVTTMVDGRYLVVSLSNGTIHIFRVRSPDS                   701 - 755
//

Text Mined References (18)

PMID Year Title