Property Summary

NCBI Gene PubMed Count 13
Grant Count 6
R01 Count 1
Funding $1,040,465.43
PubMed Score 4.92
PubTator Score 3.57

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
26889027 The C-Terminal Tail of TRIM56 Dictates Antiviral Restriction of Influenza A and B Viruses by Impeding Viral RNA Synthesis
25253338 Altogether, TRIM56 is a versatile antiviral host factor that confers resistance to yellow fever virus, dengue virus serotype 2, and human coronavirus OC43 through overlapping and distinct molecular determinants
22948160 TRIM56 is an essential component of the TLR3 antiviral signaling pathway and reveal a novel role for TRIM56 in innate antiviral immunity.
21555518 TRIM56 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
21289118 These data demonstrate that TRIM56 is a novel antiviral host factor that restricts pestivirus infection.
21074459 TRIM56 is an interferon-inducible E3 ubiquitin ligase that modulates STING to confer double-stranded DNA-mediated innate immune responses.
18854154 Knockdown of tripartite motif containing 56 (TRIM56) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MVSHGSSPSLLEALSSDFLACKICLEQLRAPKTLPCLHTYCQDCLAQLADGGRVRCPECRETVPVPPEGV      1 - 70
ASFKTNFFVNGLLDLVKARACGDLRAGKPACALCPLVGGTSTGGPATARCLDCADDLCQACADGHRCTRQ     71 - 140
THTHRVVDLVGYRAGWYDEEARERQAAQCPQHPGEALRFLCQPCSQLLCRECRLDPHLDHPCLPLAEAVR    141 - 210
ARRPGLEGLLAGVDNNLVELEAARRVEKEALARLREQAARVGTQVEEAAEGVLRALLAQKQEVLGQLRAH    211 - 280
VEAAEEAARERLAELEGREQVARAAAAFARRVLSLGREAEILSLEGAIAQRLRQLQGCPWAPGPAPCLLP    281 - 350
QLELHPGLLDKNCHLLRLSFEEQQPQKDGGKDGAGTQGGEESQSRREDEPKTERQGGVQPQAGDGAQTPK    351 - 420
EEKAQTTREEGAQTLEEDRAQTPHEDGGPQPHRGGRPNKKKKFKGRLKSISREPSPALGPNLDGSGLLPR    421 - 490
PIFYCSFPTRMPGDKRSPRITGLCPFGPREILVADEQNRALKRFSLNGDYKGTVPVPEGCSPCSVAALQS    491 - 560
AVAFSASARLYLINPNGEVQWRRALSLSQASHAVAALPSGDRVAVSVAGHVEVYNMEGSLATRFIPGGKA    561 - 630
SRGLRALVFLTTSPQGHFVGSDWQQNSVVICDGLGQVVGEYKGPGLHGCQPGSVSVDKKGYIFLTLREVN    631 - 700
KVVILDPKGSLLGDFLTAYHGLEKPRVTTMVDGRYLVVSLSNGTIHIFRVRSPDS                   701 - 755
//

Text Mined References (17)

PMID Year Title
26889027 2016 The C-Terminal Tail of TRIM56 Dictates Antiviral Restriction of Influenza A and B Viruses by Impeding Viral RNA Synthesis.
25253338 2014 Overlapping and distinct molecular determinants dictating the antiviral activities of TRIM56 against flaviviruses and coronavirus.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22948160 2012 TRIM56 is an essential component of the TLR3 antiviral signaling pathway.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21289118 2011 TRIM56 is a virus- and interferon-inducible E3 ubiquitin ligase that restricts pestivirus infection.
21074459 2010 The ubiquitin ligase TRIM56 regulates innate immune responses to intracellular double-stranded DNA.
More...